1YCR: MDM2

MDM2 bound to the transactivation domain of P53. Determined by X-ray diffraction at 2.6 Å resolution. Released 19 Nov 1997.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 818
Mol. weight: 14.34 kDa
Released: 19 Nov 1997

Explore 1YCR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YCR contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	1
β-strand	29-30	2	2
α-helix	32-39	8
β-strand	48-49	2	1
α-helix	50-63	14
β-strand	67	1	3
β-strand	74-76	3	3
α-helix	81-86	6
β-strand	90-92	3	3
α-helix	96-105	10
β-strand	107-108	2	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-23	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MDM2	A	protein	109	Homo sapiens	Q00987 (AlphaFold model)
P53	B	protein	15		P04637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YCR_1 MDM2 (chains A)
SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVY
CSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN

Sequence of entity 2 (B), FASTA

>1YCR_2 P53 (chains B)
SQETFSDLWKLLPEN

Primary citation

Structure of the MDM2 oncoprotein bound to the p53 tumor suppressor transactivation domain. Kussie, P.H., Gorina, S., Marechal, V. et al. Science (1996) 274:948-953. DOI 10.1126/science.274.5289.948 · PubMed

Other PDB entries of the same protein (UniProt Q00987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q9L 1.13 Å, HDM2 (17-111, WILDTYPE) COMPLEXED WITH COMPOUND 9 AT 1.13A; Structural states of Hdm2…
5C5A 1.15 Å, Crystal Structure of HDM2 in complex with Nutlin-3a
6Q9O 1.21 Å, HDM2 (17-111, WILDTYPE) COMPLEXED WITH COMPOUND 10 AT 1.21A; Structural states of Hdm2…
5ZXF 1.25 Å, The 1.25A Crystal structure of His6-tagged Mdm2 in complex with nutlin-3a
7QDQ 1.26 Å, Crystal Structure of HDM2 in complex with Caylin-1
8F10 1.28 Å, Structure of the MDM2 P53 binding domain in complex with H102, an all-D Helicon…
8P0D 1.31 Å, Human 14-3-3 sigma in complex with human MDM2 peptide
5Z02 1.35 Å, Crystal structure of HIS6-tagged Mdm2 with nutlin-3a
8J81 1.35 Å, MDM2 bound with a peptoid
4OGN 1.38 Å, Co-Crystal Structure of MDM2 with Inhbitor Compound 3
2AXI 1.4 Å, HDM2 in complex with a beta-hairpin
7KJM 1.4 Å, Crystal structure of human MDM2 in complex with D-peptide inhibitor (dpmi-omega)

Browse more

1YCR is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 1YCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.