Human 14-3-3 sigma in complex with human MDM2 peptide. Determined by X-ray diffraction at 1.31 Å resolution. Released 21 Feb 2024.
Explore 8P0D in 3D Show helices and sheets RCSB PDB PDBe
8P0D contains 15 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 34-37 | 4 | |
| α-helix | 38-69 | 32 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 135-137 | 3 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 165-166 | 2 | 1 |
| β-strand | 185-186 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 259 | Homo sapiens | P31947 (AlphaFold model) |
| E3 ubiquitin-protein ligase Mdm2 | B | protein | 31 | Homo sapiens | Q00987 (AlphaFold model) |
>8P0D_1 14-3-3 protein sigma (chains A) MSYYHHHHHHDYDIPTTENLYFQGAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEK GEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETEL QGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQ EAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDS YKDSTLIMQLLRDNLTLWT
>8P0D_2 E3 ubiquitin-protein ligase Mdm2 (chains B) RRRAISETEENSDELSGERQRKRHKSDSISL
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Water and common crystallization additives (CL, PEG, GOL) are not listed.
Characterizing the protein-protein interaction between MDM2 and 14-3-3 sigma ; proof of concept for small molecule stabilization. Ward, J.A., Romartinez-Alonso, B., Kay, D.F. et al. J Biol Chem (2024) 300:105651-105651. DOI 10.1016/j.jbc.2024.105651 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8P0D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.