Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. Determined by X-ray diffraction at 1.35 Å resolution. Released 1 Mar 2005.
Explore 1YN3 in 3D Show helices and sheets RCSB PDB PDBe
1YN3 contains 8 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 158-166 | 9 | 1 |
| α-helix | 172 | 1 | |
| β-strand | 173-179 | 7 | 1 |
| β-strand | 184-186 | 3 | 2 |
| α-helix | 187-202 | 16 | |
| α-helix | 206-211 | 6 | |
| β-strand | 215-221 | 7 | 1 |
| β-strand | 226-230 | 5 | 1 |
| β-strand | 240-242 | 3 | 2 |
| α-helix | 243-245 | 3 | |
| β-strand | 246-253 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| truncated cell surface protein map-w | A, B | protein | 98 | Staphylococcus aureus | Q99QS1 (AlphaFold model) |
>1YN3_1 truncated cell surface protein map-w (chains A, B) GSTVPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAK YTVNFKNGTKKVIDLKSGIYTANLINSSDIKSININID
The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. Geisbrecht, B.V., Hamaoka, B.Y., Perman, B. et al. J Biol Chem (2005) 280:17243-17250. DOI 10.1074/jbc.M412311200 · PubMed
Other PDB entries of the same protein (UniProt Q99QS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YN3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.