Crystal Structure of the Neutrophil Serine Protease Inhibitor Eap1 from S. aureus. Determined by X-ray diffraction at 1.45 Å resolution. Released 21 Dec 2022.
Explore 8D4O in 3D Show helices and sheets RCSB PDB PDBe
8D4O contains 12 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 48-52 | 5 | 1 |
| β-strand | 53-56 | 4 | 2 |
| β-strand | 67-71 | 5 | 1 |
| β-strand | 75-76 | 2 | 3 |
| α-helix | 78-93 | 16 | |
| α-helix | 97-102 | 6 | |
| β-strand | 106-112 | 7 | 2 |
| β-strand | 117-121 | 5 | 2 |
| β-strand | 132-133 | 2 | 3 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-144 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 48-52 | 5 | 4 |
| β-strand | 53-56 | 4 | 2 |
| β-strand | 67-71 | 5 | 4 |
| β-strand | 75-76 | 2 | 5 |
| α-helix | 78-93 | 16 | |
| α-helix | 97-101 | 5 | |
| β-strand | 106-112 | 7 | 2 |
| β-strand | 117-121 | 5 | 2 |
| β-strand | 132-133 | 2 | 5 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-144 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Extracellular Adherence Protein | A, B, C, D | protein | 100 | Staphylococcus aureus subsp. aureus Mu50 | Q99QS1 (AlphaFold model) |
>8D4O_1 Extracellular Adherence Protein (chains A, B, C, D) GSTIQIPYTITVNGTSQNILSSLTFNKNQNISYKDIENKVKSVLYFNRGISDIDLRLSKQ AEYTVHFKNGTKRVIDLKSGIYTADLINTSDIKAISVNVD
Characterization of two distinct neutrophil serine protease-binding modes within a Staphylococcus aureus innate immune evasion protein family. Gido, C.D., Herdendorf, T.J., Geisbrecht, B.V. J Biol Chem (2023) 299:102969-102969. DOI 10.1016/j.jbc.2023.102969 · PubMed
Other PDB entries of the same protein (UniProt Q99QS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8D4O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.