1YUF: Transforming growth factor alpha

Name: PDB 1YUF: Type alpha transforming growth factor, NMR, 16 models without energy minimization
Published: 1996-08-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

Type alpha transforming growth factor, NMR, 16 models without energy minimization. Determined by solution NMR. Released 17 Aug 1996.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 386
Mol. weight: 5.56 kDa
Released: 17 Aug 1996

Explore 1YUF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YUF contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
β-strand	22-24	3	1
β-strand	29-31	3	1
β-strand	39	1	2
β-strand	45	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor alpha	A	protein	50	Homo sapiens	P01135 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YUF_1 TRANSFORMING GROWTH FACTOR ALPHA (chains A)
VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Primary citation

Solution structure of human type-alpha transforming growth factor determined by heteronuclear NMR spectroscopy and refined by energy minimization with restraints. Moy, F.J., Li, Y.C., Rauenbuehler, P. et al. Biochemistry (1993) 32:7334-7353. DOI 10.1021/bi00080a003 · PubMed

Other PDB entries of the same protein (UniProt P01135 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3E50 2.3 Å, Crystal structure of human insulin degrading enzyme in complex with transforming growth…
1MOX 2.5 Å, Crystal Structure of Human Epidermal Growth Factor Receptor (residues 1-501) in complex…
5KN5 2.8 Å, TGFalpha/Epiregulin complex with neutralizing antibody LY3016859
7SZ7 3.4 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to…
7SZ5 3.6 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to TGF-alpha…
1GK5 Solution Structure the mEGF/TGFalpha44-50 chimeric growth factor
1YUG Type alpha transforming growth factor, NMR, 15 models after ECEPP/3 energy minimization
2TGF The solution structure of human transforming growth factor alpha
3TGF The solution structure of human transforming growth factor alpha
4TGF Solution structures of human transforming growth factor alpha derived from 1*H NMR data

Browse structure collections

About this viewer

MolViewer shows 1YUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.