2TGF: Human transforming growth factor alpha

Name: PDB 2TGF: The solution structure of human transforming growth factor alpha
Published: 1993-04-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

The solution structure of human transforming growth factor alpha. Determined by solution NMR. Released 15 Apr 1993.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 387
Mol. weight: 5.56 kDa
Released: 15 Apr 1993

Explore 2TGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2TGF contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	1
α-helix	25-27	3
β-strand	29-34	6	1
β-strand	38-39	2	2
β-strand	45-46	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor-alpha	A	protein	50	Homo sapiens	P01135 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2TGF_1 TRANSFORMING GROWTH FACTOR-ALPHA (chains A)
VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Primary citation

The solution structure of human transforming growth factor alpha. Harvey, T.S., Wilkinson, A.J., Tappin, M.J. et al. Eur J Biochem (1991) 198:555-562. DOI 10.1111/j.1432-1033.1991.tb16050.x · PubMed

Other PDB entries of the same protein (UniProt P01135 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3E50 2.3 Å, Crystal structure of human insulin degrading enzyme in complex with transforming growth…
1MOX 2.5 Å, Crystal Structure of Human Epidermal Growth Factor Receptor (residues 1-501) in complex…
5KN5 2.8 Å, TGFalpha/Epiregulin complex with neutralizing antibody LY3016859
7SZ7 3.4 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to…
7SZ5 3.6 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to TGF-alpha…
1GK5 Solution Structure the mEGF/TGFalpha44-50 chimeric growth factor
1YUF Type alpha transforming growth factor, NMR, 16 models without energy minimization
1YUG Type alpha transforming growth factor, NMR, 15 models after ECEPP/3 energy minimization
3TGF The solution structure of human transforming growth factor alpha
4TGF Solution structures of human transforming growth factor alpha derived from 1*H NMR data

Browse structure collections

About this viewer

MolViewer shows 2TGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.