Solution structure of the Josephin domain of Ataxin-3. Determined by solution NMR. Released 5 Jul 2005.
Explore 1YZB in 3D Show helices and sheets RCSB PDB PDBe
1YZB contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-22 | 9 | |
| α-helix | 30-49 | 20 | |
| α-helix | 56-62 | 7 | |
| α-helix | 78-85 | 8 | |
| β-strand | 90-93 | 4 | 1 |
| α-helix | 106-108 | 3 | |
| β-strand | 111-116 | 6 | 1 |
| β-strand | 119-126 | 8 | 1 |
| β-strand | 129-134 | 6 | 1 |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 145-158 | 14 | |
| β-strand | 161-166 | 6 | 1 |
| α-helix | 173-176 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Machado-Joseph disease protein 1 | A | protein | 182 | Homo sapiens | P54252 (AlphaFold model) |
>1YZB_1 Machado-Joseph disease protein 1 (chains A) MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRT FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM IR
The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition. Nicastro, G., Menon, R.P., Masino, L. et al. Proc Natl Acad Sci U S A (2005) 102:10493-10498. DOI 10.1073/pnas.0501732102 · PubMed
Other PDB entries of the same protein (UniProt P54252 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1YZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.