1YZK: GppNHp bound Rab11 GTPase

GppNHp bound Rab11 GTPase. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Jul 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,561
Mol. weight: 21.3 kDa
Ligands: GNP, MG
Released: 26 Jul 2005

Explore 1YZK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YZK contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	24-33	10
α-helix	40-44	5
β-strand	46-55	10	1
β-strand	58-67	10	1
α-helix	75-77	3
α-helix	78-81	4
β-strand	84-92	9	1
α-helix	96-100	5
α-helix	102-112	11
β-strand	118-124	7	1
α-helix	126-131	6
α-helix	136-145	10
β-strand	149-152	4	1
α-helix	161-174	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-11A	A	protein	184	Homo sapiens	P62491 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1YZK_1 Ras-related protein Rab-11A (chains A)
MGHHHHHHGSLVPRGSYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATR
SIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRD
HADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTE
IYRI

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of family-wide Rab GTPase recognition by rabenosyn-5. Eathiraj, S., Pan, X., Ritacco, C. et al. Nature (2005) 436:415-419. DOI 10.1038/nature03798 · PubMed

Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
2HV8 1.86 Å, Crystal structure of GTP-bound Rab11 in complex with FIP3
1OIV 1.98 Å, X-ray structure of the small G protein Rab11a in complex with GDP
4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
6IY1 2.11 Å, Structure of human Ras-related protein Rab11
4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
5EZ5 2.4 Å, Crystal structure of active Rab11A (S20V) in complex with GTP
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2

Browse structure collections

About this viewer

MolViewer shows 1YZK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.