Crystal structure of mDIA1 GBD-FH3 in complex with RhoC-GMPPNP. Determined by X-ray diffraction at 3.0 Å resolution. Released 10 May 2005.
Explore 1Z2C in 3D Show helices and sheets RCSB PDB PDBe
1Z2C contains 62 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-12 | 9 | 1 |
| α-helix | 18-26 | 9 | |
| β-strand | 39-48 | 10 | 1 |
| β-strand | 51-60 | 10 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 70-72 | 3 | |
| β-strand | 79-85 | 7 | 1 |
| α-helix | 89-94 | 6 | |
| α-helix | 95-99 | 5 | |
| α-helix | 100-106 | 7 | |
| β-strand | 112-117 | 6 | 1 |
| α-helix | 119-121 | 3 | |
| α-helix | 125-132 | 8 | |
| α-helix | 138-140 | 3 | |
| α-helix | 141-150 | 10 | |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 167-178 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 84-92 | 9 | |
| α-helix | 98-105 | 8 | |
| α-helix | 109-121 | 13 | |
| α-helix | 136-142 | 7 | |
| α-helix | 149-165 | 17 | |
| α-helix | 168-190 | 23 | |
| α-helix | 202-216 | 15 | |
| α-helix | 219-226 | 8 | |
| α-helix | 231-237 | 7 | |
| α-helix | 244-258 | 15 | |
| α-helix | 266-280 | 15 | |
| α-helix | 287-293 | 7 | |
| α-helix | 299-313 | 15 | |
| α-helix | 319-331 | 13 | |
| α-helix | 334-339 | 6 | |
| α-helix | 341-343 | 3 | |
| α-helix | 347-377 | 31 | |
| α-helix | 381-387 | 7 | |
| α-helix | 388-392 | 5 | |
| α-helix | 398-408 | 11 | |
| α-helix | 418-434 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-12 | 9 | 2 |
| α-helix | 18-25 | 8 | |
| β-strand | 39 | 1 | 3 |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 51-58 | 8 | 2 |
| β-strand | 60 | 1 | 3 |
| α-helix | 64-66 | 3 | |
| α-helix | 70-73 | 4 | |
| β-strand | 79-85 | 7 | 2 |
| α-helix | 89-94 | 6 | |
| α-helix | 95-99 | 5 | |
| α-helix | 100-106 | 7 | |
| β-strand | 112-117 | 6 | 2 |
| α-helix | 119-122 | 4 | |
| α-helix | 125-133 | 9 | |
| α-helix | 138-140 | 3 | |
| α-helix | 141-150 | 10 | |
| β-strand | 155-158 | 4 | 2 |
| α-helix | 167-177 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 86-93 | 8 | |
| α-helix | 102-105 | 4 | |
| α-helix | 109-121 | 13 | |
| α-helix | 138-143 | 6 | |
| α-helix | 149-165 | 17 | |
| α-helix | 168-189 | 22 | |
| α-helix | 203-215 | 13 | |
| α-helix | 219-227 | 9 | |
| α-helix | 231-237 | 7 | |
| α-helix | 244-258 | 15 | |
| α-helix | 266-281 | 16 | |
| α-helix | 287-293 | 7 | |
| β-strand | 295 | 1 | 4 |
| β-strand | 297 | 1 | 4 |
| α-helix | 299-313 | 15 | |
| α-helix | 319-331 | 13 | |
| α-helix | 334-341 | 8 | |
| α-helix | 347-377 | 31 | |
| α-helix | 381-391 | 11 | |
| α-helix | 398-408 | 11 | |
| α-helix | 418-433 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho-related GTP-binding protein RhoC | A, C | protein | 193 | Homo sapiens | P08134 (AlphaFold model) |
| Diaphanous protein homolog 1 | B, D | protein | 383 | Mus musculus | O08808 (AlphaFold model) |
>1Z2C_1 Rho-related GTP-binding protein RhoC (chains A, C) MAAIRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ VRKNKRRRGCPIL
>1Z2C_2 Diaphanous protein homolog 1 (chains B, D) DPTAQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMN QKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDILKR LHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMI DAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQL INALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLK GRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEEC VSQIVLHKNGTDPDFKCRHLQID
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 3 |
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 2 |
Structural and mechanistic insights into the interaction between Rho and mammalian Dia. Rose, R., Weyand, M., Lammers, M. et al. Nature (2005) 435:513-518. DOI 10.1038/nature03604 · PubMed
Other PDB entries of the same protein (UniProt P08134 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1Z2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.