2GCP: Human RhoC-GSP complex

Crystal structure of the human RhoC-GSP complex. Determined by X-ray diffraction at 2.15 Å resolution. Released 27 Mar 2007.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,644
Mol. weight: 23.46 kDa
Ligands: MG, GSP
Released: 27 Mar 2007

Explore 2GCP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GCP contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
α-helix	18-27	10
β-strand	39-48	10	1
β-strand	51-60	10	1
α-helix	64-66	3
α-helix	70-73	4
β-strand	79-85	7	1
α-helix	89-94	6
α-helix	95-99	5
α-helix	100-106	7
β-strand	112-117	6	1
α-helix	119-121	3
α-helix	125-133	9
α-helix	138-140	3
α-helix	141-150	10
β-strand	155-158	4	1
α-helix	167-178	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho-related GTP-binding protein RhoC	A	protein	201	Homo sapiens	P08134 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GCP_1 Rho-related GTP-binding protein RhoC (chains A)
MGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFE
NYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
PEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECS
AKTKEGVREVFEMATRAGLQV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
GSP	5'-guanosine-diphosphate-monothiophosphate	C10 H16 N5 O13 P3 S	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

X-ray Crystal Structures Reveal Two Activated States for RhoC. Dias, S.M.G., Cerione, R.A. Biochemistry (2007) 46:6547-6558. DOI 10.1021/bi700035p · PubMed

Other PDB entries of the same protein (UniProt P08134 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2GCO 1.4 Å, Crystal structure of the human RhoC-GppNHp complex
2GCN 1.85 Å, Crystal structure of the human RhoC-GDP complex
1Z2C 3.0 Å, Crystal structure of mDIA1 GBD-FH3 in complex with RhoC-GMPPNP

Browse structure collections

About this viewer

MolViewer shows 2GCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.