1Z3A: TRNA-specific adenosine deaminase

Crystal structure of tRNA adenosine deaminase TadA from Escherichia coli. Determined by X-ray diffraction at 2.03 Å resolution. Released 21 Feb 2006.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,684
Mol. weight: 37.85 kDa
Ligands: ZN
Released: 21 Feb 2006

Explore 1Z3A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z3A contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	19-35	17
β-strand	42-47	6	1
β-strand	50-56	7	1
α-helix	59-62	4
α-helix	69-81	13
β-strand	90-95	6	1
α-helix	99-108	10
β-strand	112-117	6	1
β-strand	125	1	2
β-strand	130	1	2
α-helix	140-141	2
β-strand	142-144	3	1
α-helix	149-164	16

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	19-35	17
β-strand	42-47	6	3
β-strand	50-56	7	3
α-helix	59-62	4
α-helix	69-81	13
β-strand	90-95	6	3
α-helix	99-108	10
β-strand	112-117	6	3
β-strand	125	1	4
β-strand	130	1	4
β-strand	142-145	4	3
α-helix	149-166	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
tRNA-specific adenosine deaminase	A, B	protein	168	Escherichia coli	P68398 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Z3A_1 tRNA-specific adenosine deaminase (chains A, B)
MLSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAE
IMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMD
VLHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase. Kim, J., Malashkevich, V., Roday, S. et al. Biochemistry (2006) 45:6407-6416. DOI 10.1021/bi0522394 · PubMed

Other PDB entries of the same protein (UniProt P68398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E2R 2.22 Å, Crystal structure of TadAC-1.14
8E2Q 2.34 Å, Crystal structure of TadAC-1.17 in a complex with ssDNA
8E2P 2.72 Å, Crystal structure of TadA*8.20 in a complex with ssDNA
8E2S 2.95 Å, Crystal structure of TadAC-1.19
6VPC 3.2 Å, Structure of the SpCas9 DNA adenine base editor - ABE8e

Browse structure collections

About this viewer

MolViewer shows 1Z3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.