8E2S: TadAC-1.19

Crystal structure of TadAC-1.19. Determined by X-ray diffraction at 2.95 Å resolution. Released 11 Jan 2023.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Escherichia coli
Chains: 8
Atoms: 9,113
Mol. weight: 149.86 kDa
Ligands: ZN
Released: 11 Jan 2023

Explore 8E2S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8E2S contains 53 α-helices and 58 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-22	4
β-strand	31-35	5	1
β-strand	40-45	6	1
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	1
α-helix	88-97	10
β-strand	101-106	6	1
β-strand	114	1	2
β-strand	119	1	2
β-strand	131-134	4	1
α-helix	138-143	6
α-helix	144-146	3

Chain B: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-22	4
β-strand	31-35	5	3
β-strand	40-45	6	3
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	3
β-strand	87	1	4
α-helix	88-97	10
β-strand	101-106	6	3
β-strand	112	1	4
β-strand	114	1	5
β-strand	119	1	5
β-strand	131-134	4	3
α-helix	138-142	5
α-helix	143-146	4

Chain C: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-22	4
β-strand	31-35	5	6
β-strand	40-45	6	6
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	6
α-helix	88-97	10
β-strand	101-106	6	6
β-strand	114	1	7
β-strand	119	1	7
β-strand	131-134	4	6
α-helix	138-144	7

Chain D: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-22	4
β-strand	31-35	5	8
β-strand	40-45	6	8
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	8
α-helix	88-97	10
β-strand	101-106	6	8
β-strand	114	1	9
β-strand	119	1	9
β-strand	131-134	4	8
α-helix	138-142	5
α-helix	143-146	4

Chain E: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-22	4
β-strand	31-35	5	10
β-strand	40-45	6	10
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	10
α-helix	88-97	10
β-strand	101-106	6	10
β-strand	114	1	11
β-strand	119	1	11
β-strand	131-134	4	10
α-helix	138-144	7
α-helix	152-154	3

Chain F: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	20-22	3
β-strand	31-35	5	12
β-strand	40-45	6	12
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	12
α-helix	88-97	10
β-strand	101-106	6	12
β-strand	114	1	13
β-strand	119	1	13
β-strand	131-134	4	12
α-helix	138-143	6
α-helix	144-146	3

Chain G: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	20-24	5
β-strand	31-35	5	14
β-strand	40-45	6	14
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	14
α-helix	88-97	10
β-strand	101-106	6	14
β-strand	114	1	15
β-strand	119	1	15
β-strand	131-134	4	14
α-helix	138-144	7

Chain H: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	20-22	3
β-strand	31-35	5	16
β-strand	40-45	6	16
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	16
α-helix	88-97	10
β-strand	101-106	6	16
β-strand	114	1	17
β-strand	119	1	17
β-strand	131-134	4	16
α-helix	138-145	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
tRNA-specific adenosine deaminase 1.19	A, B, C, D, E, F, G, H	protein	167	Escherichia coli	P68398 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>8E2S_1 tRNA-specific adenosine deaminase 1.19 (chains A, B, C, D, E, F, G, H)
MSEVEFSHEYWMRHALTLAKRARDERGVPVGAVLVLNNRVIGEGWNRANGLHDPTAHAEI
MALRQGGLVMQNYRLYDATLYSTFEPCVMCAGAMIHSRIGRVVFGVRNAKTGAAGSLMDV
LHHPGMNHRVEITEGILADECAALLCRFFRMPRRVFNAQKKAQSSTD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Primary citation

Improved cytosine base editors generated from TadA variants. Lam, D.K., Feliciano, P.R., Arif, A. et al. Nat Biotechnol (2023) 41:686-697. DOI 10.1038/s41587-022-01611-9 · PubMed

Other PDB entries of the same protein (UniProt P68398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Z3A 2.03 Å, Crystal structure of tRNA adenosine deaminase TadA from Escherichia coli
8E2R 2.22 Å, Crystal structure of TadAC-1.14
8E2Q 2.34 Å, Crystal structure of TadAC-1.17 in a complex with ssDNA
8E2P 2.72 Å, Crystal structure of TadA*8.20 in a complex with ssDNA
6VPC 3.2 Å, Structure of the SpCas9 DNA adenine base editor - ABE8e

Browse structure collections

About this viewer

MolViewer shows 8E2S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.