Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor. Determined by X-ray diffraction at 1.89 Å resolution. Released 10 May 2005.
Explore 1ZAL in 3D Show helices and sheets RCSB PDB PDBe
1ZAL contains 65 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-22 | 14 | |
| β-strand | 28-32 | 5 | 1 |
| α-helix | 36-44 | 9 | |
| α-helix | 52-63 | 12 | |
| β-strand | 73-78 | 6 | 1 |
| α-helix | 80-83 | 4 | |
| β-strand | 86 | 1 | 2 |
| β-strand | 92 | 1 | 2 |
| α-helix | 93-99 | 7 | |
| α-helix | 102 | 1 | |
| β-strand | 103-107 | 5 | 1 |
| β-strand | 112-114 | 3 | 3 |
| β-strand | 122-124 | 3 | 3 |
| α-helix | 130-139 | 10 | |
| β-strand | 144-151 | 8 | 1 |
| α-helix | 160-179 | 20 | |
| β-strand | 183-190 | 8 | 1 |
| α-helix | 198-218 | 21 | |
| α-helix | 223-225 | 3 | |
| β-strand | 227-228 | 2 | 1 |
| α-helix | 245-257 | 13 | |
| β-strand | 266-269 | 4 | 1 |
| α-helix | 276-288 | 13 | |
| β-strand | 296-301 | 6 | 1 |
| α-helix | 303-313 | 11 | |
| α-helix | 317-319 | 3 | |
| α-helix | 320-337 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-22 | 14 | |
| β-strand | 28-32 | 5 | 4 |
| α-helix | 36-45 | 10 | |
| α-helix | 52-63 | 12 | |
| α-helix | 67-69 | 3 | |
| β-strand | 73-78 | 6 | 4 |
| α-helix | 80-83 | 4 | |
| β-strand | 86 | 1 | 5 |
| β-strand | 92 | 1 | 5 |
| α-helix | 93-99 | 7 | |
| α-helix | 102 | 1 | |
| β-strand | 103-107 | 5 | 4 |
| β-strand | 112-114 | 3 | 6 |
| β-strand | 122-124 | 3 | 6 |
| α-helix | 130-139 | 10 | |
| β-strand | 144-151 | 8 | 4 |
| α-helix | 160-179 | 20 | |
| β-strand | 183-190 | 8 | 4 |
| α-helix | 198-218 | 21 | |
| α-helix | 223-225 | 3 | |
| β-strand | 227-228 | 2 | 4 |
| α-helix | 245-257 | 13 | |
| β-strand | 266-269 | 4 | 4 |
| α-helix | 276-288 | 13 | |
| β-strand | 296-301 | 6 | 4 |
| α-helix | 303-313 | 11 | |
| α-helix | 317-319 | 3 | |
| α-helix | 320-337 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-22 | 14 | |
| β-strand | 28-32 | 5 | 7 |
| α-helix | 36-44 | 9 | |
| α-helix | 52-63 | 12 | |
| α-helix | 67-69 | 3 | |
| β-strand | 73-78 | 6 | 7 |
| α-helix | 80-83 | 4 | |
| β-strand | 86 | 1 | 8 |
| β-strand | 92 | 1 | 8 |
| α-helix | 93-99 | 7 | |
| α-helix | 102 | 1 | |
| β-strand | 103-107 | 5 | 7 |
| β-strand | 112-114 | 3 | 9 |
| β-strand | 122-124 | 3 | 9 |
| α-helix | 130-139 | 10 | |
| β-strand | 144-151 | 8 | 7 |
| α-helix | 160-179 | 20 | |
| β-strand | 183-190 | 8 | 7 |
| α-helix | 198-218 | 21 | |
| α-helix | 223-225 | 3 | |
| β-strand | 227-228 | 2 | 7 |
| α-helix | 230-232 | 3 | |
| α-helix | 245-257 | 13 | |
| β-strand | 266-269 | 4 | 7 |
| α-helix | 276-288 | 13 | |
| β-strand | 296-301 | 6 | 7 |
| α-helix | 303-313 | 11 | |
| α-helix | 317-319 | 3 | |
| α-helix | 320-337 | 18 | |
| α-helix | 360-362 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-22 | 14 | |
| β-strand | 28-32 | 5 | 10 |
| α-helix | 36-44 | 9 | |
| α-helix | 52-63 | 12 | |
| β-strand | 73-78 | 6 | 10 |
| α-helix | 80-83 | 4 | |
| β-strand | 86 | 1 | 11 |
| β-strand | 92 | 1 | 11 |
| α-helix | 93-99 | 7 | |
| α-helix | 102 | 1 | |
| β-strand | 103-107 | 5 | 10 |
| β-strand | 112-114 | 3 | 12 |
| β-strand | 122-124 | 3 | 12 |
| α-helix | 130-139 | 10 | |
| β-strand | 142-151 | 10 | 10 |
| α-helix | 160-179 | 20 | |
| β-strand | 183-190 | 8 | 10 |
| α-helix | 198-218 | 21 | |
| α-helix | 223-225 | 3 | |
| β-strand | 227-228 | 2 | 10 |
| α-helix | 230-233 | 4 | |
| α-helix | 245-257 | 13 | |
| β-strand | 266-269 | 4 | 10 |
| α-helix | 276-288 | 13 | |
| β-strand | 296-301 | 6 | 10 |
| α-helix | 303-313 | 11 | |
| α-helix | 317-319 | 3 | |
| α-helix | 320-337 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fructose-bisphosphate aldolase A | A, B, C, D | protein | 363 | Oryctolagus cuniculus | P00883 (AlphaFold model) |
>1ZAL_1 Fructose-bisphosphate aldolase A (chains A, B, C, D) PHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQ LLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNG ETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQN GIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACT QKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFS YGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFISN HAY
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 8 |
High Resolution Reaction Intermediates of Rabbit Muscle Fructose-1,6-bisphosphate Aldolase: substrate cleavage and induced fit. St-Jean, M., Lafrance-Vanasse, J., Liotard, B. et al. J Biol Chem (2005) 280:27262-27270. DOI 10.1074/jbc.M502413200 · PubMed
Other PDB entries of the same protein (UniProt P00883 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.