3BV4: Fructose-bisphosphate aldolase A

Crystal structure of a rabbit muscle fructose-1,6-bisphosphate aldolase A dimer variant. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Jun 2008.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Oryctolagus cuniculus
Chains: 1
Atoms: 2,980
Mol. weight: 37.8 kDa
Ligands: 13P
Released: 24 Jun 2008

Explore 3BV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BV4 contains 17 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	9-22	14
β-strand	28-32	5	1
α-helix	36-44	9
α-helix	52-63	12
α-helix	67-69	3
β-strand	73-78	6	1
α-helix	80-83	4
β-strand	86	1	2
β-strand	92	1	2
α-helix	93-98	6
α-helix	102	1
β-strand	103-107	5	1
β-strand	112-114	3	3
β-strand	122-124	3	3
α-helix	130-139	10
β-strand	144-151	8	1
β-strand	154	1	4
β-strand	157	1	4
α-helix	160-179	20
β-strand	183-190	8	1
α-helix	198-218	21
α-helix	223-225	3
β-strand	227-228	2	1
α-helix	245-257	13
β-strand	266-269	4	1
α-helix	276-288	13
β-strand	296-301	6	1
α-helix	303-313	11
α-helix	317-319	3
α-helix	320-337	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fructose-bisphosphate aldolase A	A	protein	341	Oryctolagus cuniculus	P00883 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BV4_1 Fructose-bisphosphate aldolase A (chains A)
HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLL
TADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETT
TQGLVGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIV
PIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKY
SHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGR
ALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTS

Ligands and cofactors

ID	Name	Formula	Copies
13P	1,3-dihydroxyacetonephosphate	C3 H7 O6 P	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of a rabbit muscle fructose-1,6-bisphosphate aldolase A dimer variant. Sherawat, M., Tolan, D.R., Allen, K.N. Acta Crystallogr D Biol Crystallogr (2008) 64:543-550. DOI 10.1107/S0907444908004976 · PubMed

Other PDB entries of the same protein (UniProt P00883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TLE 1.58 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor…
1ZAI 1.76 Å, Fructose-1,6-bisphosphate Schiff base intermediate in FBP aldolase from rabbit muscle
1ZAH 1.8 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle
3DFQ 1.82 Å, D33S mutant fructose-1,6-bisphosphate aldolase from rabbit muscle
5F4X 1.84 Å, Fructose-1,6-bisphosphate aldolase K229M mutant from rabbit muscle
3DFN 1.86 Å, D33N mutant fructose-1,6-bisphosphate aldolase from rabbit muscle
2QUT 1.88 Å, Dihydroxyacetone phosphate enamine intermediate in fructose-1,6-bisphosphate aldolase…
1ZAJ 1.89 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with…
1ZAL 1.89 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially…
1ADO 1.9 Å, Fructose 1,6-bisphosphate aldolase from rabbit muscle
3DFO 1.94 Å, Dihydroxyacetone phosphate Schiff base and enamine intermediates in D33N mutant…
3DFT 1.94 Å, Phosphate ions in D33S mutant fructose-1,6-bisphosphate aldolase from rabbit muscle

Browse structure collections

About this viewer

MolViewer shows 3BV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.