1ZCD: Na+/H+ antiporter NhaA

Crystal structure of the Na+/H+ antiporter NhaA. Determined by X-ray diffraction at 3.45 Å resolution. Released 5 Jul 2005.

Method: X-ray diffraction
Resolution: 3.45 Å
Organism: Escherichia coli
Chains: 2
Atoms: 5,616
Mol. weight: 82.78 kDa
Released: 5 Jul 2005

Explore 1ZCD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZCD contains 50 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-30	18
α-helix	35-41	7
β-strand	45-50	6	1
β-strand	53-58	6	1
α-helix	59-84	26
α-helix	95-104	10
α-helix	109-112	4
α-helix	113-115	3
α-helix	122-125	4
α-helix	134-142	9
α-helix	153-174	22
α-helix	181-199	19
α-helix	206-218	13
α-helix	223-236	14
α-helix	241-243	3
α-helix	247-258	12
α-helix	259-263	5
α-helix	264-271	8
α-helix	284-287	4
α-helix	294-298	5
α-helix	301-303	3
α-helix	307-310	4
α-helix	325-328	4
α-helix	331-334	4
α-helix	339-349	11
α-helix	358-370	13
α-helix	378-380	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) antiporter 1	A, B	protein	388	Escherichia coli	P13738 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ZCD_1 Na(+)/H(+) antiporter 1 (chains A, B)
MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNML
LWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADP
ITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLS
MASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK
EKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGK
PLGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINW
AKLGILVGSISSAVIGYSWLRVRLRPSV

Primary citation

Structure of a Na+/H+ antiporter and insights into mechanism of action and regulation by pH. Hunte, C., Screpanti, E., Venturi, M. et al. Nature (2005) 435:1197-1202. DOI 10.1038/nature03692 · PubMed

Other PDB entries of the same protein (UniProt P13738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S24 2.2 Å, Crystal structure of the Na+/H+ antiporter NhaA at pH 6.5
9RH1 2.7 Å, Cryo-EM structure of the consensus inward-facing apo NhaA dimer at pH 7.5
9RH2 2.7 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 7.5
9RH3 2.7 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 7.5
9RHB 2.9 Å, Cryo-EM structure of the inward-facing apo NhaA in the open-funnel state at pH 8.5
9RHF 3.0 Å, Cryo-EM structure of the inward-facing sodium-bound NhaA at pH 8.5
9RH4 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA with flexible N-terminus at pH 7.5
9RH8 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 5.5
9RH9 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 5.5
9RHC 3.2 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 8.5
9RHD 3.2 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 8.5
9RH5 3.3 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 6.3

Browse more

1ZCD is part of these collections:

Membrane proteins and transporters

About this viewer

MolViewer shows 1ZCD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.