1ZKA: Transcription factor RelB

Name: PDB 1ZKA: NF-kB RelB forms an intertwined homodimer, Y300S mutant
Published: 2005-05-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

NF-kB RelB forms an intertwined homodimer, Y300S mutant. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 May 2005.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 1
Atoms: 925
Mol. weight: 12.32 kDa
Released: 10 May 2005

Explore 1ZKA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZKA contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	270-272	3	1
β-strand	275-277	3	1
β-strand	283-286	4	2
β-strand	301-303	3	2
α-helix	308-310	3
β-strand	314-316	3	3
β-strand	321-323	3	3
α-helix	328-330	3
α-helix	340-344	5
β-strand	353-357	5	4
β-strand	360	1	5
β-strand	367	1	5
α-helix	368-370	3
β-strand	371-375	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor RelB	A	protein	110	Mus musculus	Q04863 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZKA_1 Transcription factor RelB (chains A)
LVPRGSHMNTSELRICRINKESGPCTGGEELSLLCDKVQKEDISVVFSTASWEGRADFSQ
ADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR

Primary citation

NF-kappaB RelB forms an intertwined homodimer. Huang, D.B., Vu, D., Ghosh, G. Structure (2005) 13:1365-1373. DOI 10.1016/j.str.2005.06.018 · PubMed

Other PDB entries of the same protein (UniProt Q04863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZK9 2.18 Å, NF-kB RelB forms an intertwined homodimer
4JHB 2.44 Å, Crystal structure of RelB double mutants: Y300F/I335F
3JUZ 2.51 Å, Crystal structure of a mutant of RelB dimerization domain(M5)
3JSS 2.6 Å, Crystal structure of a mutant RelB dimerization domain
3JV0 2.65 Å, Crystal structure of a mutant of RelB dimerization domain(M6)
3JV6 2.78 Å, Crystal structure of the dimerization domains p52 and RelB
4JGM 3.0 Å, Crystal structure of RelB double mutants: Y300F/I335V
2V2T 3.05 Å, X-ray structure of a NF-kB p50-RelB-DNA complex
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
3JV4 3.15 Å, Crystal structure of the dimerization domains p50 and RelB

Browse structure collections

About this viewer

MolViewer shows 1ZKA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.