1ZMS: LMP1 Protein binds to TRAF3 as a structural CD40

LMP1 Protein binds to TRAF3 as a structural CD40. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Jul 2005.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,586
Mol. weight: 22.75 kDa
Released: 19 Jul 2005

Explore 1ZMS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZMS contains 7 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	314-346	33
β-strand	353-359	7	1
α-helix	361-369	9
β-strand	376-377	2	2
α-helix	378-380	3
β-strand	381-382	2	2
β-strand	389-395	7	2
α-helix	400-402	3
β-strand	406-414	9	2
α-helix	419-421	3
β-strand	430-434	5	1
β-strand	444-448	5	1
β-strand	464	1	2
β-strand	468-475	8	2
α-helix	476-481	6
β-strand	489-496	8	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	205-206	2	2
α-helix	207-208	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor associated factor 3	A	protein	192	Homo sapiens	Q13114 (AlphaFold model)
Latent membrane protein 1	B	protein	8		P13198

Sequence of entity 1 (A), FASTA

>1ZMS_1 TNF receptor associated factor 3 (chains A)
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGK
TLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL
MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFI
KVIVDTSDLPDP

Sequence of entity 2 (B), FASTA

>1ZMS_2 Latent membrane protein 1 (chains B)
HPQQATDD

Primary citation

LMP1 protein from the Epstein Barr virus is a structural CD40 decoy in B lymphocytes fro binding to TRAF3. Wu, S.D., Xie, P., Welsh, K. et al. J Biol Chem (2005) 39:33620-33626. DOI 10.1074/jbc.M502511200 · PubMed

Other PDB entries of the same protein (UniProt Q13114 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T5P 2.5 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF3 TRAF domain
2GKW 2.7 Å, Key contacts promote recongnito of BAFF-R by TRAF3
1FLK 2.8 Å, Molecular basis for CD40 signaling mediated by TRAF3
8ZUK 2.83 Å, Cluster structure of the BAFF-BAFFR-TRAF3 complex
1L0A 2.9 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1FLL 3.5 Å, Molecular basis for CD40 signaling mediated by TRAF3
1KZZ 3.5 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1RF3 3.5 Å, Structurally Distinct Recognition Motifs in Lymphotoxin-B Receptor and CD40 for…
2ECY Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF…

Browse structure collections

About this viewer

MolViewer shows 1ZMS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.