1ZRZ: Protein kinase C, iota

Crystal Structure of the Catalytic Domain of Atypical Protein Kinase C-iota. Determined by X-ray diffraction at 3.0 Å resolution. Released 13 Sept 2005.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,523
Mol. weight: 42.41 kDa
Ligands: BI1
Released: 13 Sept 2005

Explore 1ZRZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZRZ contains 19 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	245-253	9	1
β-strand	257-264	8	1
β-strand	270-277	8	1
α-helix	278-280	3
α-helix	287-297	11
β-strand	306	1	2
β-strand	309-312	4	1
β-strand	314	1	1
β-strand	318-324	7	1
β-strand	330	1	2
α-helix	331-336	6
α-helix	343-362	20
β-strand	366	1	3
α-helix	372-374	3
β-strand	375-377	3	2
α-helix	378	1
β-strand	383-385	3	2
β-strand	392	1	3
β-strand	401	1	4
α-helix	408-410	3
α-helix	413-416	4
β-strand	421	1	4
α-helix	424-439	16
α-helix	457-467	11
α-helix	469-473	5
α-helix	478-487	10
α-helix	503-509	7
α-helix	511-513	3
α-helix	518-521	4
α-helix	527-528	2
α-helix	553-557	5
α-helix	559-562	4
α-helix	568-570	3
β-strand	575-576	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein kinase C, iota	A	protein	364	Homo sapiens	P41743 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZRZ_1 Protein kinase C, iota (chains A)
EKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVND
DEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPE
EHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTST
FCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQ
VILEKQIRIPRSMSVKAASVLKSFLNKDPKERLGCLPQTGFADIQGHPFFRNVDWDMMEQ
KQVVPPFKPNISGEFGLDNFDSQFTNERVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSA
EECV

Ligands and cofactors

ID	Name	Formula	Copies
BI1	3-{1-[3-(dimethylamino)propyl]-1H-indol-3-yl}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-…	C25 H24 N4 O2	1

Primary citation

Crystal Structure of the Catalytic Domain of Human Atypical Protein Kinase C-iota Reveals Interaction Mode of Phosphorylation Site in Turn Motif. Messerschmidt, A., Macieira, S., Velarde, M. et al. J Mol Biol (2005) 352:918-931. DOI 10.1016/j.jmb.2005.07.060 · PubMed

Other PDB entries of the same protein (UniProt P41743 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WMH 1.5 Å, Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha
5LI9 1.79 Å, Structure of a nucleotide-bound form of PKCiota core kinase domain
3A8X 2.0 Å, Crystal Structure of PKCiota kinase domain
5LI1 2.0 Å, Structure of a Par3-inhibitory peptide bound to PKCiota core kinase domain
3A8W 2.1 Å, Crystal Structure of PKCiota kinase domain
8R3X 2.59 Å, Crystal structure of aPKC Iota kinase domain with LLGL2 peptide
3ZH8 2.74 Å, A novel small molecule aPKC inhibitor
9EJK 3.08 Å, Lgl2 bound to the aPKCiota-Par6b complex in nucleotide-free form. Head sub-complex…
5LIH 3.25 Å, Structure of a peptide-substrate bound to PKCiota core kinase domain
6ILZ 3.26 Å, Crystal structure of PKCiota in complex with inhibitor
9EJM 3.33 Å, Lgl2 bound to the aPKCiota-Par6B complex in its ADP-bound form
9EJL 3.48 Å, Lgl2 bound to the aPKCiota-Par6B complex in nucleotide-free form. Conformation with…

Browse structure collections

About this viewer

MolViewer shows 1ZRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.