Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6). Determined by X-ray diffraction at 2.9 Å resolution. Released 31 Jan 2006.
Explore 1ZSH in 3D Show helices and sheets RCSB PDB PDBe
1ZSH contains 5 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| β-strand | 19-22 | 4 | 1 |
| β-strand | 26-29 | 4 | 2 |
| β-strand | 34 | 1 | 2 |
| β-strand | 37-42 | 6 | 1 |
| β-strand | 52-64 | 13 | 3 |
| β-strand | 75-85 | 11 | 3 |
| α-helix | 101-108 | 8 | |
| β-strand | 112-117 | 6 | 1 |
| α-helix | 124-125 | 2 | |
| β-strand | 127-129 | 3 | 3 |
| β-strand | 139-151 | 13 | 3 |
| β-strand | 164-168 | 5 | 3 |
| β-strand | 169-172 | 4 | 2 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-189 | 7 | 4 |
| β-strand | 196-203 | 8 | 4 |
| β-strand | 207-209 | 3 | 5 |
| β-strand | 214-222 | 9 | 4 |
| β-strand | 228-241 | 14 | 6 |
| β-strand | 247-258 | 12 | 6 |
| β-strand | 262 | 1 | 6 |
| β-strand | 267-274 | 8 | 4 |
| β-strand | 288-289 | 2 | 3 |
| β-strand | 295 | 1 | 7 |
| β-strand | 300 | 1 | 3 |
| α-helix | 301-303 | 3 | |
| α-helix | 313-315 | 3 | |
| β-strand | 317-329 | 13 | 6 |
| β-strand | 343-349 | 7 | 6 |
| β-strand | 350-352 | 3 | 5 |
| β-strand | 388-389 | 2 | 1 |
| β-strand | 395 | 1 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-arrestin 1 | A | protein | 418 | Bos taurus | P17870 (AlphaFold model) |
>1ZSH_1 Beta-arrestin 1 (chains A) MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP PHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPRLNDR
Nonvisual arrestin oligomerization and cellular localization are regulated by inositol hexakisphosphate binding. Milano, S.K., Kim, Y.M., Stefano, F.P. et al. J Biol Chem (2006) 281:9812-9823. DOI 10.1074/jbc.M512703200 · PubMed
Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.