1ZY2: Transcriptional regulator NtrC1

Name: PDB 1ZY2: Crystal structure of the phosphorylated receiver domain of the transcription regulator NtrC1 from Aquifex aeolicus
Published: 2005-08-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the phosphorylated receiver domain of the transcription regulator NtrC1 from Aquifex aeolicus. Determined by X-ray diffraction at 3.03 Å resolution. Released 16 Aug 2005.

Method: X-ray diffraction
Resolution: 3.03 Å
Organism: Aquifex aeolicus
Chains: 2
Atoms: 2,126
Mol. weight: 35.07 kDa
Ligands: MG
Released: 16 Aug 2005

Explore 1ZY2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZY2 contains 11 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	10-23	14
β-strand	26-28	3	1
α-helix	33-39	7
β-strand	47-51	5	1
β-strand	53	1	2
β-strand	58	1	2
α-helix	59-69	11
β-strand	74-79	6	1
α-helix	84-92	9
β-strand	97-100	4	1
α-helix	105-131	27
α-helix	135-137	3

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	3
α-helix	10-23	14
β-strand	26-28	3	3
α-helix	33-42	10
β-strand	47-49	3	3
β-strand	53	1	4
β-strand	58	1	4
α-helix	60-69	10
β-strand	74-75	2	3
β-strand	76-79	4	5
α-helix	84-93	10
β-strand	97-100	4	5
α-helix	105-120	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
transcriptional regulator NtrC1	A, B	protein	150	Aquifex aeolicus	O67198 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ZY2_1 transcriptional regulator NtrC1 (chains A, B)
MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLLPDVNGL
EILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRK
LRKENELLRREKDLKEKLAAALEHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Negative regulation of AAA + ATPase assembly by two component receiver domains: a transcription activation mechanism that is conserved in mesophilic and extremely hyperthermophilic bacteria. Doucleff, M., Chen, B., Maris, A.E. et al. J Mol Biol (2005) 353:242-255. DOI 10.1016/j.jmb.2005.08.003 · PubMed

Other PDB entries of the same protein (UniProt O67198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L5E 1.34 Å, Crystal structure of A. aeolicus NtrC1 DNA binding domain
4L4U 2.2 Å, Crystal structure of construct containing A. aeolicus NtrC1 receiver, central and DNA…
1NY5 2.4 Å, Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
3M0E 2.63 Å, Crystal structure of the ATP-bound state of Walker B mutant of NtrC1 ATPase domain
9MSE 2.7 Å, de novo SigN RNA polymerase transcription initiation intermediate with pre-catalytic…
9MSG 2.7 Å, De novo SigN RNA polymerase transcription initiation intermediate with bound SigN-RII
1NY6 3.1 Å, Crystal structure of sigm54 activator (AAA+ ATPase) in the active state
4LZZ 3.21 Å, Nucleotide-induced asymmetry within atpase activator ring drives s54-RNAP interaction…
4LY6 3.6 Å, Nucleotide-induced asymmetry within ATPase activator ring drives s54-RNAP interaction…
4BT1 16.0 Å, MuB is an AAAplus ATPase that forms helical filaments to control target selection for…
4BT0 17.0 Å, MuB is an AAAplus ATPase that forms helical filaments to control target selection for…

Browse structure collections

About this viewer

MolViewer shows 1ZY2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.