4L5E: A. aeolicus NtrC1 DNA binding domain
Crystal structure of A. aeolicus NtrC1 DNA binding domain. Determined by X-ray diffraction at 1.34 Å resolution. Released 28 Aug 2013.
- Method
- X-ray diffraction
- Resolution
- 1.34 Å
- Organism
- Aquifex aeolicus
- Chains
- 1
- Atoms
- 501
- Mol. weight
- 5.66 kDa
- Released
- 28 Aug 2013
Explore 4L5E in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4L5E contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 396-410 | 15 | |
| α-helix | 415-422 | 8 | |
| α-helix | 426-436 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Transcriptional regulator (NtrC family) | A | protein | 46 | Aquifex aeolicus | O67198 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>4L5E_1 Transcriptional regulator (NtrC family) (chains A)
HKSIKEIEKEEIIKVLKEVNFNKKLASEILGIPLRTLYKRLKEYGI
Primary citation
Structure, function, and tethering of DNA-binding domains in sigma (54) transcriptional activators. Vidangos, N., Maris, A.E., Young, A. et al. Biopolymers (2013) 99:1082-1096. DOI 10.1002/bip.22333 · PubMed
Other PDB entries of the same protein (UniProt O67198 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4L4U 2.2 Å, Crystal structure of construct containing A. aeolicus NtrC1 receiver, central and DNA…
- 1NY5 2.4 Å, Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state
- 9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
- 3M0E 2.63 Å, Crystal structure of the ATP-bound state of Walker B mutant of NtrC1 ATPase domain
- 9MSE 2.7 Å, de novo SigN RNA polymerase transcription initiation intermediate with pre-catalytic…
- 9MSG 2.7 Å, De novo SigN RNA polymerase transcription initiation intermediate with bound SigN-RII
- 1ZY2 3.03 Å, Crystal structure of the phosphorylated receiver domain of the transcription regulator…
- 1NY6 3.1 Å, Crystal structure of sigm54 activator (AAA+ ATPase) in the active state
- 4LZZ 3.21 Å, Nucleotide-induced asymmetry within atpase activator ring drives s54-RNAP interaction…
- 4LY6 3.6 Å, Nucleotide-induced asymmetry within ATPase activator ring drives s54-RNAP interaction…
- 4BT1 16.0 Å, MuB is an AAAplus ATPase that forms helical filaments to control target selection for…
- 4BT0 17.0 Å, MuB is an AAAplus ATPase that forms helical filaments to control target selection for…
Browse structure collections
About this viewer
MolViewer shows 4L5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.