1ZY3: Apoptosis regulator Bcl-W

Name: PDB 1ZY3: Structural model of complex of Bcl-w protein with Bid BH3-peptide
Published: 2006-02-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Structural model of complex of Bcl-w protein with Bid BH3-peptide. Determined by solution NMR. Released 14 Feb 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,467
Mol. weight: 21.9 kDa
Released: 14 Feb 2006

Explore 1ZY3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZY3 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	9-23	15
α-helix	40-48	9
α-helix	51-56	6
α-helix	59-66	8
α-helix	75-86	12
α-helix	92-111	20
α-helix	115-129	15
α-helix	134-140	7
α-helix	144-149	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	203-217	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator Bcl-W	A	protein	178	Homo sapiens	Q92843 (AlphaFold model)
BH3-peptide from BH3 interacting domain death agonist protein	B	protein	20	Homo sapiens	P55957 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ZY3_1 Apoptosis regulator Bcl-W (chains A)
ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTF
SDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQ
VQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRLEHHHHHH

Sequence of entity 2 (B), FASTA

>1ZY3_2 BH3-peptide from BH3 interacting domain death agonist protein (chains B)
IIKNIARHLAQVGDSMDRSI

Primary citation

Structural Model of the BCL-w-BID Peptide Complex and Its Interactions with Phospholipid Micelles. Denisov, A.Y., Chen, G., Sprules, T. et al. Biochemistry (2006) 45:2250-2256. DOI 10.1021/bi052332s · PubMed

Other PDB entries of the same protein (UniProt Q92843 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CIM 1.5 Å, Complex of a Bcl-w BH3 mutant with a BH3 domain
2Y6W 2.0 Å, Structure of a Bcl-w dimer
1MK3 Solution structure of human bcl-W protein
1O0L The structure of bcl-W reveals a role for the C-terminal residues in modulating…

Browse structure collections

About this viewer

MolViewer shows 1ZY3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.