22GM: C5a bound C5aR1

C5a bound C5aR1 in complex with beta-arrestin1. Determined by electron microscopy at 2.7 Å resolution. Released 22 Jul 2026.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Homo sapiens, Mus musculus, Bos taurus
Chains: 5
Atoms: 7,309
Mol. weight: 127.33 kDa
Released: 22 Jul 2026

Explore 22GM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

22GM contains 31 α-helices and 52 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	2
β-strand	18-22	5	2
β-strand	26-28	3	7
β-strand	29-30	2	8
β-strand	33-34	2	8
β-strand	37-43	7	2
β-strand	52-62	11	9
β-strand	77-87	11	9
α-helix	91-93	3
α-helix	95-97	3
α-helix	99-108	10
β-strand	112-117	6	2
α-helix	123-126	4
β-strand	127-129	3	9
β-strand	141-151	11	9
β-strand	164-168	5	9
β-strand	169-171	3	7
α-helix	181-182	2
β-strand	183-188	6	10
α-helix	196	1
β-strand	197-203	7	10
β-strand	207-208	2	11
β-strand	214-223	10	10
β-strand	228-242	15	12
β-strand	246-258	13	12
β-strand	262	1	12
β-strand	265-274	10	10
β-strand	288-290	3	9
α-helix	293-295	3
β-strand	300	1	9
α-helix	301-305	5
β-strand	317-329	13	12
β-strand	342-349	8	12
β-strand	350-351	2	11

Chain C: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-12	7
α-helix	16-26	11
α-helix	35-38	4
α-helix	45-61	17
α-helix	62-64	3
β-strand	68-69	2	1

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	3
β-strand	13-15	3	4
β-strand	21-28	8	3
β-strand	35-42	8	4
β-strand	48-55	8	4
β-strand	60-63	4	4
α-helix	65-67	3
β-strand	68	1	3
β-strand	71-76	6	3
β-strand	81-86	6	3
α-helix	91-93	3
β-strand	95-103	9	4
β-strand	112-113	2	4
β-strand	117-121	5	4

Chain L: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	5
β-strand	11-14	4	6
β-strand	20-26	7	5
β-strand	34-39	6	6
β-strand	46-49	4	6
β-strand	63-68	6	5
β-strand	71-76	6	5
α-helix	81-83	3
β-strand	86-91	6	6
β-strand	98-99	2	6
β-strand	103-107	5	6

Chain R: 15 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
α-helix	35-65	31
α-helix	71-87	17
α-helix	89-97	9
α-helix	106-138	33
α-helix	141-144	4
α-helix	150-174	25
β-strand	175-181	7	1
β-strand	184-190	7	1
α-helix	196-207	12
α-helix	208-212	5
α-helix	213-229	17
α-helix	238-264	27
α-helix	273-288	16
α-helix	289-291	3
α-helix	292-302	11
α-helix	307-313	7
β-strand	361-364	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C5a anaphylatoxin	C	protein	74	Homo sapiens	P01031 (AlphaFold model)
C5a anaphylatoxin chemotactic receptor 1,Vasopressin V2 receptor	R	protein	371	Homo sapiens	P21730 (AlphaFold model), P30518 (AlphaFold model)
Fab30 heavy chain	H	protein	193	Mus musculus
Fab30 light chain	L	protein	164	Homo sapiens
Beta-arrestin-1	A	protein	347	Bos taurus	P17870 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>22GM_1 C5a anaphylatoxin (chains C)
TLQKKIEEIAAKYKHSVVKKCCYDGARVNNDETCEQRAARISLGPRCIKAFTECCVVASQ
LRANISHKDMQLGR

Sequence of entity 2 (R), FASTA

>22GM_2 C5a anaphylatoxin chemotactic receptor 1,Vasopressin V2 receptor (chains R)
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRGGGSGGGSGGASARGREPPELGPQDESCTT
ASSSLAKDTSS

Sequence of entity 3 (H), FASTA

>22GM_3 Fab30 heavy chain (chains H)
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYA
DSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTVSSA
STKGPSVFPLLGCLVKDYFPEPVTVSWNSGALGVHTFPAVLQSSGLYSLSSVVTVYICNV
NHKPSNTKVDKKV

Sequence of entity 4 (L), FASTA

>22GM_4 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKASVVCLLNNPRQSGNSQESVTEQDSKDSTYSLSSTLT

Sequence of entity 5 (A), FASTA

>22GM_5 Beta-arrestin-1 (chains A)
TRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGR
EDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPC
SVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGPQPTAE
TTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFN
TAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTL
LREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLM

Primary citation

Atypical signaling, ligand recognition and selective agonist discovery of complement receptor C5aR2. Qin, J., Cai, C., Shan, M. et al. Cell Res (2026) 36:718-733. DOI 10.1038/s41422-026-01273-1 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 22GM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.