23VF: CEACAM1

Crystal structure of CEACAM1 in complex with MG1124 antibody. Determined by X-ray diffraction at 1.79 Å resolution. Released 26 Aug 2026.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Homo sapiens
Chains: 6
Atoms: 8,762
Mol. weight: 118.95 kDa
Released: 26 Aug 2026

Explore 23VF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

23VF contains 38 α-helices and 116 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	5	1	2
β-strand	9-12	4	3
β-strand	18-23	6	2
α-helix	26-30	5
β-strand	35-39	5	3
β-strand	46-49	4	3
β-strand	50	1	4
β-strand	54	1	4
β-strand	63-68	6	2
β-strand	71-76	6	2
α-helix	81-83	3
β-strand	85-93	9	3
β-strand	98-101	4	3
β-strand	102	1	1
β-strand	105-109	5	3
α-helix	112-114	3
β-strand	115	1	5
α-helix	116-117	2
β-strand	118-122	5	6
α-helix	123-125	3
α-helix	126-130	5
β-strand	134-143	10	6
β-strand	144	1	5
β-strand	149-154	6	7
β-strand	157-158	2	7
β-strand	163-165	3	6
α-helix	166-168	3
β-strand	169-170	2	6
β-strand	176-184	9	6
α-helix	186-191	6
β-strand	195-201	7	7
β-strand	204-210	7	7

Chain B: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
α-helix	29-31	3
β-strand	33-39	7	10
β-strand	46-53	8	10
β-strand	57-60	4	10
α-helix	62-64	3
β-strand	68-73	6	8
α-helix	74-76	3
β-strand	78-83	6	8
α-helix	88-90	3
β-strand	92-99	8	10
β-strand	110-111	2	10
β-strand	115-117	3	10
β-strand	118-119	2	9
α-helix	123-124	2
β-strand	125	1	11
α-helix	126-127	2
β-strand	128-132	5	12
α-helix	133-135	3
β-strand	143-153	11	12
β-strand	154	1	11
β-strand	159-162	4	13
α-helix	163-165	3
β-strand	171-173	3	12
α-helix	174-176	3
β-strand	177-178	2	12
β-strand	184-193	10	12
α-helix	195-197	3
β-strand	202-208	7	13
α-helix	209-211	3
β-strand	213-219	7	13

Chain C: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	14
β-strand	5	1	15
β-strand	9-12	4	16
β-strand	18-23	6	15
α-helix	26-30	5
β-strand	34-39	6	16
β-strand	46-49	4	16
β-strand	50	1	17
β-strand	54	1	17
β-strand	63-68	6	15
β-strand	71-76	6	15
α-helix	81-83	3
β-strand	85-93	9	16
β-strand	98-101	4	16
β-strand	102	1	14
β-strand	105-109	5	16
β-strand	115	1	18
α-helix	116-117	2
β-strand	118-122	5	19
α-helix	123-125	3
α-helix	126-129	4
β-strand	134-143	10	19
β-strand	144	1	18
β-strand	149-154	6	20
β-strand	157-158	2	20
β-strand	163-165	3	19
α-helix	166-168	3
β-strand	169-170	2	19
β-strand	176-184	9	19
α-helix	186-191	6
β-strand	195-201	7	20
β-strand	204-210	7	20

Chain D: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	21
β-strand	11-12	2	22
β-strand	18-25	8	21
α-helix	29-31	3
β-strand	33-39	7	23
β-strand	45-53	9	23
β-strand	57-60	4	23
β-strand	68-73	6	21
α-helix	74-76	3
β-strand	78-83	6	21
α-helix	88-90	3
β-strand	92-99	8	23
β-strand	110-111	2	23
β-strand	115-117	3	23
β-strand	118-119	2	22
β-strand	125	1	24
α-helix	126-127	2
β-strand	128-132	5	25
β-strand	143-153	11	25
β-strand	154	1	24
β-strand	159-162	4	26
α-helix	163-165	3
β-strand	171-173	3	25
α-helix	174-176	3
β-strand	177-178	2	25
β-strand	184-193	10	25
α-helix	194-196	3
β-strand	202-208	7	26
α-helix	209-211	3
β-strand	213-219	7	26

Chains E and F: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	27
β-strand	12-13	2	28
β-strand	19-24	6	27
β-strand	30-37	8	29
α-helix	43-45	3
β-strand	46-51	6	29
β-strand	56-59	4	29
β-strand	67-69	3	27
β-strand	75-77	3	27
α-helix	82-84	3
β-strand	86-94	9	29
β-strand	99-106	8	29
β-strand	107-108	2	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MG1124 Light Chain	A, C	protein	215	Homo sapiens
MG1124 Heavy Chain	B, D	protein	231	Homo sapiens
Cell adhesion molecule CEACAM1	E, F	protein	110	Homo sapiens	P13688 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>23VF_1 MG1124 Light Chain (chains A, C)
QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYADSRRPSGVP
DRFSGSKSGTSASLAISGLRSEDEADYYCGAWDLSLNGYVFGGGTKLTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC

Sequence of entity 2 (B, D), FASTA

>23VF_2 MG1124 Heavy Chain (chains B, D)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSVISHGGGSIYY
ADSVKGRLTISRDNSKNTLYLQMNSLRAEDTAVYYCARDPTKGYAPTFDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP

Sequence of entity 3 (E, F), FASTA

>23VF_3 Cell adhesion molecule CEACAM1 (chains E, F)
GHMQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATP
GPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY

Primary citation

Preclinical characterization and efficacy of MG1124, a CEACAM1-targeting immune checkpoint antibody for cancer immunotherapy. Oh, B.-H., Kim, S., Lee, C.-W. et al. To be published.

Other PDB entries of the same protein (UniProt P13688 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MU8 1.7 Å, Structure of the minimally glycosylated human CEACAM1 N-terminal domain
6XO1 1.76 Å, Crystal structure of N97A mutant of human CEACAM1
6XNO 1.9 Å, Crystal structure of E99A mutant of human CEACAM1
6XNW 1.9 Å, Crystal structure of V39A mutant of human CEACAM1
4QXW 2.04 Å, Crystal structure of the human CEACAM1 membrane distal amino terminal (N)-domain
9U94 2.11 Å, Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1
2GK2 2.2 Å, Crystal structure of the N terminal domain of human CEACAM1
7RPP 2.2 Å, Crystal structure of human CEACAM1 with GFCC' and ABED face
4WHD 2.5 Å, Human CEACAM1 N-domain homodimer
6GBH 2.59 Å, Helicobacter pylori adhesin HopQ type II bound to the N-terminal domain of human CEACAM1
6AW2 2.68 Å, Crystal structure of the HopQ-CEACAM1 complex
9GH5 2.7 Å, Complex of Fusobacterium nucleatum CbpF with human CEACAM1

Browse structure collections

About this viewer

MolViewer shows 23VF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.