24OK: Human dUTPase

Crystal structure of human dUTPase complexed with Zinc. Determined by X-ray diffraction at 2.01 Å resolution. Released 1 Apr 2026.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,055
Mol. weight: 20.02 kDa
Ligands: ZN
Released: 1 Apr 2026

Explore 24OK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

24OK contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	27-30	4	1
β-strand	47-51	5	2
β-strand	56-58	3	3
β-strand	62-67	6	4
β-strand	70-73	4	1
α-helix	74-75	2
β-strand	78-84	7	2
α-helix	85	1
α-helix	88-92	5
β-strand	94-96	3	4
α-helix	99	1
β-strand	100-101	2	2
α-helix	102	1
β-strand	110-115	6	4
β-strand	121-123	3	3
β-strand	128-136	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial	A	protein	184	Homo sapiens	P33316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>24OK_1 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial (chains A)
MASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTR
GSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGV
IDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGS
TGKN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	5

Water and common crystallization additives (EDO) are not listed.

Primary citation

Human dUTPase crystal structure and... Krinkel, B.A., Yosaatmadja, Y., Loomes, K.M. et al. To be published.

Other PDB entries of the same protein (UniProt P33316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ARA 1.7 Å, Discovery of Novel Uracil Derivatives as Potent Human dUTPase Inhibitors
3ARN 1.8 Å, Human dUTPase in complex with novel uracil derivative
3EHW 1.8 Å, Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the…
5H4J 1.8 Å, Crystal structure of Human dUTPase in complex with N-[(1R)-1-[3-(Cyclopentyloxy)-phenyl]-…
4MZ6 1.88 Å, Structure of importin-alpha: dUTPase S11E NLS mutant complex
7PWJ 1.94 Å, dUTPase from human in complex with Stl
1Q5H 2.0 Å, Human dUTP Pyrophosphatase complex with dUDP
1Q5U 2.0 Å, Human dutp pyrophosphatase
4MZ5 2.1 Å, Structure of importin-alpha: dUTPase NLS complex
2HQU 2.2 Å, Human dUTPase in complex with alpha,beta-iminodUTP and magnesium ion
8C8I 3.2 Å, Human dUTPase in complex with a potent proteinaceous inhibitor (Stl)

Browse structure collections

About this viewer

MolViewer shows 24OK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.