7PWJ: DUTPase from human

dUTPase from human in complex with Stl. Determined by X-ray diffraction at 1.94 Å resolution. Released 28 Dec 2022.

Method: X-ray diffraction
Resolution: 1.94 Å
Organisms: Staphylococcus aureus, Homo sapiens
Chains: 6
Atoms: 7,052
Mol. weight: 104.4 kDa
Released: 28 Dec 2022

Explore 7PWJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PWJ contains 41 α-helices and 42 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	16	1	2
β-strand	24-28	5	2
β-strand	33-35	3	3
β-strand	39-44	6	4
β-strand	47-50	4	1
α-helix	51-52	2
β-strand	55-60	6	2
α-helix	63-69	7
β-strand	71-74	4	4
β-strand	77-78	2	2
β-strand	87-92	6	4
β-strand	98-100	3	3
β-strand	105-113	9	2
β-strand	114-115	2	5
α-helix	117	1
β-strand	118-121	4	6

Chain BBB: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	16	1	8
β-strand	24-28	5	8
β-strand	33-35	3	9
β-strand	39-44	6	10
β-strand	47-50	4	7
α-helix	51-52	2
β-strand	55-60	6	8
α-helix	63-69	7
β-strand	71-74	4	10
β-strand	77-78	2	8
β-strand	87-92	6	10
β-strand	98-100	3	9
β-strand	105-113	9	8
β-strand	114-115	2	2
α-helix	117	1
β-strand	118-121	4	1
α-helix	125-128	4

Chain CCC: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	29-36	8
α-helix	40-48	9
α-helix	55-65	11
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-130	13
α-helix	136-138	3
α-helix	141-152	12

Chain DDD: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	6
β-strand	16	1	5
β-strand	24-28	5	5
β-strand	33-35	3	11
β-strand	39-44	6	12
β-strand	47-50	4	6
α-helix	51-52	2
β-strand	55-60	6	5
α-helix	63-69	7
β-strand	71-74	4	12
β-strand	77-78	2	5
β-strand	87-92	6	12
β-strand	98-100	3	11
β-strand	105-113	9	5
β-strand	114-115	2	8
β-strand	119-121	3	7
α-helix	125-128	4

Chain EEE: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	29-36	8
α-helix	40-48	9
α-helix	55-65	11
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-131	14
α-helix	141-152	12

Chain FFF: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	29-36	8
α-helix	40-47	8
α-helix	55-65	11
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-132	15
α-helix	141-153	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Orf20	CCC, EEE, FFF	protein	156	Staphylococcus aureus	Q9F0J8 (AlphaFold model)
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial	AAA, BBB, DDD	protein	145	Homo sapiens	P33316 (AlphaFold model)

Sequence of entity 1 (CCC, EEE, FFF), FASTA

>7PWJ_1 Orf20 (chains CCC, EEE, FFF)
MEGAGQMAELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEI
YGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYD
ETIKLLELLKESKINVNDIDYDYVLKLYKQILSTDT

Sequence of entity 2 (AAA, BBB, DDD), FASTA

>7PWJ_2 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial (chains AAA, BBB, DDD)
YFQGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCY
GRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFY
PEIEEVQALDDTERGSGGFGSTGKN

Primary citation

The Bacteriophage-Phage-Inducible Chromosomal Island Arms Race Designs an Interkingdom Inhibitor of dUTPases. Sanz-Frasquet, C., Ciges-Tomas, J.R., Alite, C. et al. Microbiol Spectr (2023) 11:e0323222-e0323222. DOI 10.1128/spectrum.03232-22 · PubMed

Other PDB entries of the same protein (UniProt Q9F0J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H49 1.8 Å, A polyamorous repressor: deciphering the evolutionary strategy used by the…
6H48 2.2 Å, A polyamorous repressor: deciphering the evolutionary strategy used by the…
9TRU 2.26 Å, Zebrafish dUTPase in complex with staphylococcal Stl repressor
6H4C 2.52 Å, A polyamorous repressor: deciphering the evolutionary strategy used by the…
7DLV 2.52 Å, shrimp dUTPase in complex with Stl
7PWX 2.75 Å, dUTPase from M. tuberculosis in complex with Stl
6H4B 2.9 Å, A polyamorous repressor: deciphering the evolutionary strategy used by the…
8C8I 3.2 Å, Human dUTPase in complex with a potent proteinaceous inhibitor (Stl)
8P8O 3.4 Å, M. tuberculosis dUTPase - Stl1-159 (StlNT) complex structure

Browse structure collections

About this viewer

MolViewer shows 7PWJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.