256B: Cytochrome B562

Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the primary structure and using molecular graphics. Determined by X-ray diffraction at 1.4 Å resolution. Released 15 Jan 1991.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,923
Mol. weight: 25.22 kDa
Ligands: HEM
Released: 15 Jan 1991

Explore 256B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

256B contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	23-40	18
α-helix	46-48	3
α-helix	56-80	25
α-helix	84-91	8
α-helix	93-105	13

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	23-40	18
α-helix	46-48	3
α-helix	56-80	25
α-helix	84-92	9
α-helix	94-105	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytochrome B562	A, B	protein	106	Escherichia coli	P0ABE7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>256B_1 CYTOCHROME B562 (chains A, B)
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics. Lederer, F., Glatigny, A., Bethge, P.H. et al. J Mol Biol (1981) 148:427-448. DOI 10.1016/0022-2836(81)90185-6 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y
6OT8 1.5 Å, Bimetallic hexameric cage design 4 (BMC4) from cytochrome cb562

Browse structure collections

About this viewer

MolViewer shows 256B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.