5YO6: B562RIL with engineered disulfide bond T9C-A36C

Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C. Determined by X-ray diffraction at 1.2 Å resolution. Released 14 Mar 2018.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Escherichia coli
Chains: 1
Atoms: 963
Mol. weight: 11.82 kDa
Released: 14 Mar 2018

Explore 5YO6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YO6 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-19	15
α-helix	23-41	19
α-helix	56-80	25
α-helix	84-97	14
α-helix	98-102	5
α-helix	103-105	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562	A	protein	106	Escherichia coli	P0ABE7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YO6_1 Soluble cytochrome b562 (chains A)
ADLEDNWECLNDNLKVIEKADNAAQVKDALTKMRACALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL

Primary citation

Protein crystal quality oriented disulfide bond engineering. Pu, M., Xu, Z., Peng, Y. et al. Protein Cell (2018) 9:659-663. DOI 10.1007/s13238-017-0482-7 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y
6OT8 1.5 Å, Bimetallic hexameric cage design 4 (BMC4) from cytochrome cb562

Browse structure collections

About this viewer

MolViewer shows 5YO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.