Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C. Determined by X-ray diffraction at 1.2 Å resolution. Released 14 Mar 2018.
Explore 5YO6 in 3D Show helices and sheets RCSB PDB PDBe
5YO6 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-19 | 15 | |
| α-helix | 23-41 | 19 | |
| α-helix | 56-80 | 25 | |
| α-helix | 84-97 | 14 | |
| α-helix | 98-102 | 5 | |
| α-helix | 103-105 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Soluble cytochrome b562 | A | protein | 106 | Escherichia coli | P0ABE7 (AlphaFold model) |
>5YO6_1 Soluble cytochrome b562 (chains A) ADLEDNWECLNDNLKVIEKADNAAQVKDALTKMRACALDAQKATPPKLEDKSPDSPEMKD FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL
Protein crystal quality oriented disulfide bond engineering. Pu, M., Xu, Z., Peng, Y. et al. Protein Cell (2018) 9:659-663. DOI 10.1007/s13238-017-0482-7 · PubMed
Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.