Catalytic antibody 5C8, FAB-hapten complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Mar 1999.
Explore 25C8 in 3D Show helices and sheets RCSB PDB PDBe
25C8 contains 15 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 6 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 45-52 | 8 | 7 |
| β-strand | 56-59 | 4 | 7 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 6 |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 7 |
| β-strand | 102-103 | 2 | 7 |
| β-strand | 107-111 | 5 | 7 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 8 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 9 |
| β-strand | 137-147 | 11 | 9 |
| β-strand | 148 | 1 | 8 |
| β-strand | 153-157 | 4 | 10 |
| β-strand | 166 | 1 | 10 |
| β-strand | 171-173 | 3 | 9 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 9 |
| β-strand | 185-194 | 10 | 9 |
| β-strand | 205-212 | 7 | 10 |
| β-strand | 217-223 | 7 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| α-helix | 30-32 | 3 | |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 3 |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-127 | 6 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 144-150 | 7 | 5 |
| β-strand | 153-155 | 3 | 5 |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-198 | 8 | 5 |
| β-strand | 205-210 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IgG 5C8 | L | protein | 212 | Mus musculus | P01837 (AlphaFold model) |
| IgG 5C8 | H | protein | 217 | Mus musculus | P01869 (AlphaFold model) |
>25C8_1 IGG 5C8 (chains L) DIVLTQSPAIMSASLGERVTMTCTASSSVSSSNLHWYQQKPGSSPKLWIYSTSNLASGVP ARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLEIKRADAAPTVSIFP PSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTL TLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
>25C8_2 IGG 5C8 (chains H) EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQKPEQGLEWIAQIDPANGNTKY DPKFQGKATITADTSSNTAYLHLSSLTSEDSAVYYCAADPPYYGHGDYWGQGTTLTVSSA KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
| ID | Name | Formula | Copies |
|---|---|---|---|
| GEP | N-methyl-N-(para-glutaramidophenyl-ethyl)-piperidinium ion | C19 H29 N2 O3 | 1 |
Structural basis for antibody catalysis of a disfavored ring closure reaction. Gruber, K., Zhou, B., Houk, K.N. et al. Biochemistry (1999) 38:7062-7074. DOI 10.1021/bi990210s · PubMed
Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 25C8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.