26LK: Human LAS1L-NOL9 complex

Cryo-EM structure of human LAS1L-NOL9 complex. Determined by electron microscopy at 3.4 Å resolution. Released 3 Jun 2026.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 11,504
Mol. weight: 325.17 kDa
Released: 3 Jun 2026

Explore 26LK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

26LK contains 66 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	42	1	1
α-helix	48-58	11
α-helix	63-79	17
α-helix	86-102	17
α-helix	108-122	15
α-helix	123-127	5
α-helix	149-159	11
α-helix	163-165	3
α-helix	166-180	15
α-helix	181-185	5
α-helix	186-190	5
α-helix	620-630	11
β-strand	634	1	2
β-strand	636	1	2
β-strand	639-640	2	3
α-helix	654-655	2
β-strand	671-673	3	4
β-strand	680	1	5

Chain B: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	42	1	6
α-helix	48-58	11
α-helix	63-79	17
α-helix	86-102	17
α-helix	108-122	15
α-helix	123-127	5
α-helix	149-160	12
α-helix	163-165	3
α-helix	166-180	15
α-helix	181-185	5
α-helix	186-190	5
α-helix	620-630	11
β-strand	634	1	7
β-strand	636	1	7
β-strand	639-640	2	8
β-strand	671-673	3	9
β-strand	680	1	10

Chain C: 22 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	118	1	11
β-strand	124-126	3	11
β-strand	135	1	12
β-strand	140-146	7	11
β-strand	148-151	4	13
β-strand	154-157	4	13
α-helix	161-162	2
β-strand	163-165	3	11
β-strand	175	1	12
β-strand	177-178	2	13
α-helix	179	1
α-helix	188-202	15
α-helix	205-213	9
β-strand	221-225	5	11
α-helix	230-237	8
α-helix	256-264	9
α-helix	279-293	15
α-helix	295-297	3
β-strand	301-304	4	14
α-helix	312-324	13
β-strand	330-334	5	14
β-strand	347-348	2	15
β-strand	350-353	4	14
β-strand	372-373	2	15
α-helix	384-395	12
β-strand	403-406	4	14
α-helix	413-426	14
β-strand	430-432	3	14
β-strand	434-435	2	16
α-helix	440-441	2
α-helix	447-452	6
α-helix	494	1
β-strand	495-496	2	14
β-strand	499-500	2	16
α-helix	510-527	18
α-helix	528-531	4
α-helix	533-534	2
α-helix	538-539	2
β-strand	548-549	2	3
β-strand	550-551	2	4
β-strand	556-559	4	4
α-helix	569-571	3
β-strand	577-581	5	4
β-strand	595-597	3	4
β-strand	602	1	5
β-strand	608-615	8	4
β-strand	620-624	5	4
α-helix	629-632	4
β-strand	637-640	4	4
α-helix	647-651	5
α-helix	659-660	2
β-strand	663	1	1

Chain D: 21 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	118	1	17
β-strand	124-126	3	17
β-strand	135	1	18
β-strand	140-146	7	17
β-strand	148-151	4	19
β-strand	154-157	4	19
α-helix	161-162	2
β-strand	163-165	3	17
β-strand	175	1	18
β-strand	177-178	2	19
α-helix	188-202	15
α-helix	205-213	9
β-strand	221-225	5	17
α-helix	230-237	8
α-helix	256-264	9
α-helix	279-293	15
α-helix	295-297	3
β-strand	301-304	4	20
α-helix	312-324	13
β-strand	330-334	5	20
β-strand	347-348	2	21
β-strand	349-353	5	20
β-strand	372-373	2	21
α-helix	383-395	13
β-strand	403-406	4	20
α-helix	413-426	14
β-strand	430-432	3	20
β-strand	434-435	2	22
α-helix	440-441	2
α-helix	447-452	6
α-helix	494	1
β-strand	495-496	2	20
β-strand	499-500	2	22
α-helix	510-527	18
α-helix	528-530	3
α-helix	533-534	2
α-helix	538-539	2
β-strand	548-549	2	8
β-strand	550-551	2	9
β-strand	556-559	4	9
α-helix	569-571	3
β-strand	577-581	5	9
β-strand	595-597	3	9
β-strand	602	1	10
β-strand	608-615	8	9
β-strand	620-624	5	9
α-helix	629-632	4
β-strand	637-640	4	9
α-helix	647-651	5
α-helix	659-660	2
β-strand	663	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal biogenesis protein LAS1L	A, B	protein	734	Homo sapiens	Q9Y4W2 (AlphaFold model)
Polynucleotide 5'-hydroxyl-kinase NOL9	C, D	protein	702	Homo sapiens	Q5SY16 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>26LK_1 Ribosomal biogenesis protein LAS1L (chains A, B)
MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVYLFC
DDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLGTDELRLLYGMALV
RFVNLISERKTKFAKVPLKCLAQEVNIPDWIVDLRHELTHKKMPHINDCRRGCYFVLDWL
QKTYWCRQLENSLRETWELEEFREGIEEEDQEEDKNIVVDDITEQKPEPQDDGKSTESDV
KADGDSKGSEEVDSHCKKALSHKELYERARELLVSYEEEQFTVLEKFRYLPKAIKAWNNP
SPRVECVLAELKGVTCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQTEVQRGEGTD
PKSHKNVDLNDVLVPKPFSQFWQPLLRGLHSQNFTQALLERMLSELPALGISGIRPTYIL
RWTVELIVANTKTGRNARRFSAGQWEARRGWRLFNCSASLDWPRMVESCLGSPCWASPQL
LRIIFKAMGQGLPDEEQEKLLRICSIYTQSGENSLVQEGSEASPIGKSPYTLDSLYWSVK
PASSSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDD
EEEDRMEVGPFSTGQESPTAENARLLAQKRGALQGSAWQVSSEDVRWDTFPLGRMPGQTE
DPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCGVGSGNCSNSSSSNFEGLLWS
QGQLHGLKTGLQLF

Sequence of entity 2 (C, D), FASTA

>26LK_2 Polynucleotide 5'-hydroxyl-kinase NOL9 (chains C, D)
MADSGLLLKRGSCRSTWLRVRKARPQLILSRRPRRRLGSLRWCGRRRLRWRLLQAQASGV
DWREGARQVSRAAAARRPNTATPSPIPSPTPASEPESEPELESASSCHRPLLIPPVRPVG
PGRALLLLPVEQGFTFSGICRVTCLYGQVQVFGFTISQGQPAQDIFSVYTHSCLSIHALH
YSQPEKSKKELKREARNLLKSHLNLDDRRWSMQNFSPQCSIVLLEHLKTATVNFITSYPG
SSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELVNVSCEEVDGCP
VILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITEPVLGP
PFTHLRTPQKMVYYGKPSCKNNYENYIDIVKYVFSAYKRESPLIVNTMGWVSDQGLLLLI
DLIRLLSPSHVVQFRSDHSKYMPDLTPQYVDDMDGLYTKSKTKMRNRRFRLAAFADALEF
ADEEKESPVEFTGHKLIGVYTDFAFRITPRNRESHNKILRDLSILSYLSQLQPPMPKPLS
PLHSLTPYQVPFNAVALRITHSDVAPTHILYAVNASWVGLCKIQDDVRGYTNGPILLAQT
PICDCLGFGICRGIDMEKRLYHILTPVPPEELRTVNCLLVGAIAIPHCVLKCQRGIEGTV
PYVTTDYNFKLPGASEKIGAREPEEAHKEKPYRRPKFCRKMK

Primary citation

Cryo-EM structure of human LAS1L-NOL9 complex. Zhu, J., Li, Y., Cheng, J. To be published.

Other PDB entries of the same protein (UniProt Q9Y4W2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FL3 2.53 Å, Human nuclear pre-60S ribosomal subunit (State I2)
8FL2 2.67 Å, Human nuclear pre-60S ribosomal subunit (State I1)
8FL4 2.89 Å, Human nuclear pre-60S ribosomal subunit (State I3)
9DUN 3.32 Å, Human LAS1L-NOL9 complex
10RR 3.5 Å, Human RNase PNK bound to AMPPNP ligand + rCAA in PNK active site
10RN 3.6 Å, Human RNase PNK bound to ATPyS ligand

Browse structure collections

About this viewer

MolViewer shows 26LK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.