28IP: InhA from Mycobacterium tuberculosis

structure of InhA from Mycobacterium tuberculosis in complex with 4-(4-hexyl-2-hydroxyphenoxy)benzaldehyde (compound 5a) - spacegroup C2. Determined by X-ray diffraction at 1.59 Å resolution. Released 15 Jul 2026.

Method: X-ray diffraction
Resolution: 1.59 Å
Organism: Mycobacterium tuberculosis
Chains: 4
Atoms: 8,826
Mol. weight: 119.52 kDa
Ligands: A1JY8, NAD
Released: 15 Jul 2026

Explore 28IP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

28IP contains 60 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
α-helix	21-31	11
β-strand	35-40	6	1
α-helix	44-51	8
β-strand	60-62	3	1
α-helix	68-82	15
β-strand	88-93	6	1
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	1
β-strand	154	1	2
α-helix	159-180	22
β-strand	185-191	7	1
α-helix	197	1
α-helix	198-203	6
α-helix	204-206	3
α-helix	211-225	15
α-helix	236-246	11
β-strand	256-260	5	1
α-helix	264-266	3
β-strand	267	1	3

Chain B: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	4
α-helix	21-31	11
β-strand	35-40	6	4
α-helix	44-51	8
β-strand	60-62	3	4
α-helix	68-82	15
β-strand	88-93	6	4
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	4
β-strand	154	1	5
α-helix	159-180	22
β-strand	185-191	7	4
α-helix	197-200	4
α-helix	222-225	4
α-helix	236-246	11
β-strand	256-260	5	4
α-helix	264-266	3
β-strand	267	1	6

Chain C: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	7
α-helix	21-31	11
β-strand	35-40	6	7
α-helix	44-51	8
β-strand	60-62	3	7
α-helix	68-82	15
β-strand	88-93	6	7
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	7
β-strand	154	1	3
α-helix	159-180	22
β-strand	185-191	7	7
α-helix	192-193	2
α-helix	197-207	11
α-helix	208-210	3
α-helix	211-225	15
α-helix	236-246	11
β-strand	256-260	5	7
α-helix	264-266	3
β-strand	267	1	2

Chain D: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	8
α-helix	21-31	11
α-helix	34	1
β-strand	35-40	6	8
α-helix	44-51	8
β-strand	60-62	3	8
α-helix	68-82	15
β-strand	88-93	6	8
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	8
β-strand	154	1	6
α-helix	159-180	22
β-strand	185-191	7	8
α-helix	209-225	17
α-helix	236-246	11
β-strand	256-260	5	8
α-helix	264-266	3
β-strand	267	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enoyl-[acyl-carrier-protein] reductase [NADH]	A, B, C, D	protein	272	Mycobacterium tuberculosis	P9WGR1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>28IP_1 Enoyl-[acyl-carrier-protein] reductase [NADH] (chains A, B, C, D)
GSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAK
APLLELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVS
KGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAR
EAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATP
VAKTVCALLSDWLPATTGDIIYADGGAHTQLL

Ligands and cofactors

ID	Name	Formula	Copies
A1JY8	4-(4-hexyl-2-hydroxyphenoxy)benzaldehyde	C19 H22 O3	4
NAD	Nicotinamide-adenine-dinucleotide	C21 H27 N7 O14 P2	4

Water and common crystallization additives (GOL, DMS) are not listed.

Primary citation

Rational Design of Diaryl Ether-Based Dual Inhibitors Targeting Successive Essential Enzymes HadAB and InhA in Mycobacterium tuberculosis . Tamhaev, R., Recchia, D., Zahorszka, M. et al. J Med Chem (2026) 69:17366-17382. DOI 10.1021/acs.jmedchem.6c01302 · PubMed

Other PDB entries of the same protein (UniProt P9WGR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TRO 1.4 Å, Structure of the enoyl-ACP reductase of Mycobacterium tuberculosis InhA, inhibited with…
28IQ 1.51 Å, structure of InhA from Mycobacterium tuberculosis in complex with…
28IT 1.51 Å, structure of InhA from Mycobacterium tuberculosis in complex with…
5G0T 1.54 Å, InhA in complex with a DNA encoded library hit
4OHU 1.6 Å, Crystal structure of Mycobacterium tuberculosis InhA in complex with inhibitor PT92
8OTM 1.6 Å, structure of InhA from mycobacterium tuberculosis in complex with…
4TZK 1.62 Å, Crystal structure of Mycobacterium tuberculosis enoyl reductase (INHA) complexed WITH…
4U0J 1.62 Å, Crystal structure of Mycobacterium tuberculosis enoyl reductase (INHA) complexed with…
4D0S 1.64 Å, Mtb InhA complex with Pyradizinone compound 14
9RJK 1.66 Å, Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative…
28IR 1.69 Å, structure of InhA from Mycobacterium tuberculosis in complex with…
9RJL 1.7 Å, Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative…

Browse structure collections

About this viewer

MolViewer shows 28IP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.