structure of InhA from Mycobacterium tuberculosis in complex with 4-(4-hexyl-2-hydroxyphenoxy)benzaldehyde (compound 5a) - spacegroup P41212. Determined by X-ray diffraction at 1.51 Å resolution. Released 15 Jul 2026.
Explore 28IQ in 3D Show helices and sheets RCSB PDB PDBe
28IQ contains 56 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 21-31 | 11 | |
| β-strand | 35-40 | 6 | 1 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 100-102 | 3 | |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 1 |
| β-strand | 154 | 1 | 2 |
| α-helix | 159-180 | 22 | |
| β-strand | 185-191 | 7 | 1 |
| α-helix | 197-200 | 4 | |
| α-helix | 215-225 | 11 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 1 |
| α-helix | 264-266 | 3 | |
| β-strand | 267 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 4 |
| α-helix | 21-31 | 11 | |
| β-strand | 35-40 | 6 | 4 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 4 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 4 |
| α-helix | 100-102 | 3 | |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 4 |
| β-strand | 154 | 1 | 5 |
| α-helix | 159-180 | 22 | |
| β-strand | 185-191 | 7 | 4 |
| α-helix | 197-201 | 5 | |
| α-helix | 210-225 | 16 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 4 |
| α-helix | 264-266 | 3 | |
| β-strand | 267 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 8 |
| α-helix | 21-31 | 11 | |
| β-strand | 35-40 | 6 | 8 |
| α-helix | 44-51 | 8 | |
| β-strand | 60-62 | 3 | 8 |
| α-helix | 68-82 | 15 | |
| β-strand | 88-93 | 6 | 8 |
| α-helix | 100-102 | 3 | |
| α-helix | 108-110 | 3 | |
| α-helix | 113-120 | 8 | |
| α-helix | 121-125 | 5 | |
| α-helix | 126-134 | 9 | |
| α-helix | 135-137 | 3 | |
| β-strand | 138-148 | 11 | 8 |
| β-strand | 154 | 1 | 3 |
| α-helix | 159-180 | 22 | |
| β-strand | 185-191 | 7 | 8 |
| α-helix | 197-200 | 4 | |
| α-helix | 213-225 | 13 | |
| α-helix | 236-246 | 11 | |
| β-strand | 256-260 | 5 | 8 |
| α-helix | 264-266 | 3 | |
| β-strand | 267 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl-[acyl-carrier-protein] reductase [NADH] | A, B, C, D | protein | 272 | Mycobacterium tuberculosis | P9WGR1 (AlphaFold model) |
>28IQ_1 Enoyl-[acyl-carrier-protein] reductase [NADH] (chains A, B, C, D) GSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAK APLLELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVS KGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAR EAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATP VAKTVCALLSDWLPATTGDIIYADGGAHTQLL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 4 |
| A1JY8 | 4-(4-hexyl-2-hydroxyphenoxy)benzaldehyde | C19 H22 O3 | 4 |
Water and common crystallization additives (DMS) are not listed.
Rational Design of Diaryl Ether-Based Dual Inhibitors Targeting Successive Essential Enzymes HadAB and InhA in Mycobacterium tuberculosis . Tamhaev, R., Recchia, D., Zahorszka, M. et al. J Med Chem (2026) 69:17366-17382. DOI 10.1021/acs.jmedchem.6c01302 · PubMed
Other PDB entries of the same protein (UniProt P9WGR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 28IQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.