Crystal structure of Human Catenin Beta-1 in complex with cyclic beta sheet peptide inhibitor. Determined by X-ray diffraction at 2.09 Å resolution. Released 23 Sept 2026.
Explore 29KL in 3D Show helices and sheets RCSB PDB PDBe
29KL contains 38 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 153-160 | 8 | |
| α-helix | 165-178 | 14 | |
| α-helix | 182-189 | 8 | |
| α-helix | 192-203 | 12 | |
| α-helix | 208-221 | 14 | |
| α-helix | 225-232 | 8 | |
| α-helix | 236-243 | 8 | |
| α-helix | 249-265 | 17 | |
| α-helix | 269-275 | 7 | |
| α-helix | 278-284 | 7 | |
| α-helix | 285-287 | 3 | |
| α-helix | 291-305 | 15 | |
| α-helix | 309-317 | 9 | |
| α-helix | 320-330 | 11 | |
| α-helix | 334-348 | 15 | |
| α-helix | 353-359 | 7 | |
| α-helix | 362-367 | 6 | |
| α-helix | 375-388 | 14 | |
| α-helix | 389-391 | 3 | |
| α-helix | 399-408 | 10 | |
| α-helix | 414-427 | 14 | |
| α-helix | 432-440 | 9 | |
| α-helix | 443-454 | 12 | |
| α-helix | 458-470 | 13 | |
| α-helix | 478-487 | 10 | |
| α-helix | 491-496 | 6 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-523 | 3 | |
| α-helix | 524-529 | 6 | |
| α-helix | 532-549 | 18 | |
| β-strand | 561 | 1 | 1 |
| β-strand | 564 | 1 | 1 |
| α-helix | 566-580 | 15 | |
| α-helix | 584-592 | 9 | |
| α-helix | 596-601 | 6 | |
| α-helix | 602-604 | 3 | |
| α-helix | 608-621 | 14 | |
| α-helix | 625-633 | 9 | |
| α-helix | 637-643 | 7 | |
| α-helix | 649-663 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 2 |
| β-strand | 10-15 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Catenin beta-1 | A | protein | 506 | Homo sapiens | P35222 (AlphaFold model) |
| cyclic kilo N4V | B | protein | 16 | Homo sapiens |
>29KL_1 Catenin beta-1 (chains A) RAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET ARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAK MAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRT YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSD AATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRT VLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKAT VGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRFVEGVRMEEIVEGCTGALHI LARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP LTELLHSRNEGVATYAAAVLFRMSED
>29KL_2 cyclic kilo N4V (chains B) XVTRVDVPPDSLLVFX
| ID | Name | Formula | Copies |
|---|---|---|---|
| GLC | alpha-D-glucopyranose | C6 H12 O6 | 7 |
Water and common crystallization additives (CL, NA) are not listed.
To be decided please. Klintrot, C.I.R., Hennig, S., Grossmann, T.N. To be published (2026). DOI 10.1002/ceur.70357
Other PDB entries of the same protein (UniProt P35222 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 29KL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.