2A20: Rim2 Zinc Finger Domain

Solution structure of Rim2 Zinc Finger Domain. Determined by solution NMR. Released 16 Aug 2005.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 464
Mol. weight: 7 kDa
Ligands: ZN
Released: 16 Aug 2005

Explore 2A20 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A20 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	88-90	3
β-strand	106-107	2	1
β-strand	108	1	2
β-strand	114-115	2	1
β-strand	120-124	5	2
β-strand	130-134	5	2
α-helix	135-140	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulating synaptic membrane exocytosis protein 2	A	protein	62	Rattus norvegicus	Q9JIS1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2A20_1 Regulating synaptic membrane exocytosis protein 2 (chains A)
GSQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQ
QE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

A Munc13/RIM/Rab3 tripartite complex: from priming to plasticity? Dulubova, I., Lou, X., Lu, J. et al. EMBO J (2005) 24:2839-2850. DOI 10.1038/sj.emboj.7600753 · PubMed

Other PDB entries of the same protein (UniProt Q9JIS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BWQ 1.41 Å, Crystal Structure of the RIM2 C2A-domain at 1.4 angstrom Resolution
2CJS 1.78 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…

Browse structure collections

About this viewer

MolViewer shows 2A20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.