Cholera toxin A1 subunit bound to its substrate, NAD+, and its human protein activator, ARF6. Determined by X-ray diffraction at 2.02 Å resolution. Released 16 Aug 2005.
Explore 2A5F in 3D Show helices and sheets RCSB PDB PDBe
2A5F contains 27 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-20 | 8 | 1 |
| α-helix | 26-35 | 10 | |
| β-strand | 47-54 | 8 | 1 |
| β-strand | 57-64 | 8 | 1 |
| α-helix | 68-77 | 10 | |
| β-strand | 83-89 | 7 | 1 |
| α-helix | 93-95 | 3 | |
| α-helix | 96-107 | 12 | |
| α-helix | 110-112 | 3 | |
| β-strand | 116-122 | 7 | 1 |
| α-helix | 129-131 | 3 | |
| α-helix | 132-138 | 7 | |
| α-helix | 141-143 | 3 | |
| β-strand | 149-154 | 6 | 1 |
| β-strand | 155 | 1 | 2 |
| β-strand | 160 | 1 | 2 |
| α-helix | 162-171 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 3 |
| α-helix | 13-18 | 6 | |
| β-strand | 21-22 | 2 | 4 |
| α-helix | 25-33 | 9 | |
| α-helix | 35-37 | 3 | |
| β-strand | 38 | 1 | 5 |
| α-helix | 41-46 | 6 | |
| β-strand | 57 | 1 | 5 |
| β-strand | 59-63 | 5 | 3 |
| α-helix | 66-73 | 8 | |
| β-strand | 82-89 | 8 | 3 |
| β-strand | 94-96 | 3 | 3 |
| α-helix | 97-101 | 5 | |
| α-helix | 102-104 | 3 | |
| α-helix | 108-110 | 3 | |
| β-strand | 112-116 | 5 | 3 |
| β-strand | 119-120 | 2 | 4 |
| α-helix | 121-123 | 3 | |
| β-strand | 124-131 | 8 | 3 |
| β-strand | 134 | 1 | 3 |
| α-helix | 138-139 | 2 | |
| β-strand | 140-141 | 2 | 3 |
| α-helix | 142 | 1 | |
| α-helix | 147-150 | 4 | |
| α-helix | 155-157 | 3 | |
| α-helix | 158-161 | 4 | |
| α-helix | 162-164 | 3 | |
| α-helix | 172-175 | 4 | |
| α-helix | 179-182 | 4 | |
| α-helix | 183-184 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ADP-ribosylation factor 6 | A | protein | 175 | Homo sapiens | P62330 (AlphaFold model) |
| Cholera enterotoxin, A chain | B | protein | 193 | Vibrio cholerae | P01555 (AlphaFold model) |
>2A5F_1 ADP-ribosylation factor 6 (chains A) MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
>2A5F_2 Cholera enterotoxin, A chain (chains B) SNDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGY VSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDDQDVSALGGI PYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPW IHHAPPGSGNAPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 1 |
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 1 |
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (GOL, NA) are not listed.
Structural basis for the activation of cholera toxin by human ARF6-GTP. O'Neal, C.J., Jobling, M.G., Holmes, R.K. et al. Science (2005) 309:1093-1096. DOI 10.1126/science.1113398 · PubMed
Other PDB entries of the same protein (UniProt P62330 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2A5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.