2A66: Orphan nuclear receptor NR5A2

Human Liver Receptor Homologue DNA-Binding Domain (hLRH-1 DBD) in Complex with dsDNA from the hCYP7A1 Promoter. Determined by X-ray diffraction at 2.2 Å resolution. Released 6 Dec 2005.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,328
Mol. weight: 20.73 kDa
Ligands: ZN
Released: 6 Dec 2005

Explore 2A66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A66 contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	85	1	1
α-helix	91	1
β-strand	92	1	1
β-strand	93-97	5	2
β-strand	100-103	4	2
α-helix	104-115	12
α-helix	139-148	10
α-helix	153-155	3
α-helix	169-177	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(gptptpcpapapgpgpcpcpapg)-3'	B	DNA	12	Homo sapiens
5'-d(cptpgpgpcpcptptpgpapapc)-3'	C	DNA	12	Homo sapiens
Orphan nuclear receptor NR5A2	A	protein	113	Homo sapiens	O00482 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2A66_1 5'-D(*GP*TP*TP*CP*AP*AP*GP*GP*CP*CP*AP*G)-3' (chains B)
GTTCAAGGCCAG

Sequence of entity 2 (C), FASTA

>2A66_2 5'-D(*CP*TP*GP*GP*CP*CP*TP*TP*GP*AP*AP*C)-3' (chains C)
CTGGCCTTGAAC

Sequence of entity 3 (A), FASTA

>2A66_3 Orphan nuclear receptor NR5A2 (chains A)
GEFGDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQ
RKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (ACT) are not listed.

Primary citation

Crystal Structure of the Human LRH-1 DBD-DNA Complex Reveals Ftz-F1 Domain Positioning is Required for Receptor Activity. Solomon, I.H., Hager, J.M., Safi, R. et al. J Mol Biol (2005) 354:1091-1102. DOI 10.1016/j.jmb.2005.10.009 · PubMed

Other PDB entries of the same protein (UniProt O00482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VC2 1.7 Å, LRH-1 bound to SS-RJW100 and a fragment of the Tif2 Coactivator
3PLZ 1.75 Å, Human LRH1 LBD bound to GR470
4PLD 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
4PLE 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to an E. Coli…
4ONI 1.8 Å, Structure of Human Orphan Receptor LRH1 bound to two bacterial phospholipids
5L11 1.85 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to RJW100 and a Fragment of TIF-2
4RWV 1.86 Å, Crystal structure of PIP3 bound human nuclear receptor LRH-1 (Liver Receptor Homolog 1,…
1YUC 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to Phospholipid and a…
4DOR 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
5SYZ 1.93 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to a RJW100 stereoisomer and a Fragment…
5UNJ 1.96 Å, Structure of Human Liver Receptor Homolog 1 in complex with PGC1a and RJW100
4DOS 2.0 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to DLPC and a Fragment…

Browse structure collections

About this viewer

MolViewer shows 2A66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.