2A74: Human Complement Component C3c

Human Complement Component C3c. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Sept 2005.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 6
Atoms: 18,389
Mol. weight: 266.88 kDa
Released: 27 Sept 2005

Explore 2A74 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A74 contains 66 α-helices and 192 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	9	1	2
β-strand	11-12	2	3
β-strand	17-19	3	4
β-strand	21-25	5	1
β-strand	31-39	9	3
β-strand	47	1	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	61-62	2	1
β-strand	65-67	3	4
β-strand	83-90	8	3
β-strand	93-101	9	3
β-strand	107-112	6	5
β-strand	116-117	2	6
β-strand	122-130	9	5
β-strand	136	1	5
β-strand	140-146	7	6
β-strand	152-154	3	6
β-strand	157-159	3	6
β-strand	166-172	7	5
β-strand	180-188	9	6
β-strand	196-202	7	6
β-strand	210-216	7	7
β-strand	221-222	2	8
β-strand	229-237	9	7
α-helix	241	1
β-strand	242	1	7
α-helix	243	1
β-strand	245-255	11	9
β-strand	258-271	14	9
β-strand	272	1	7
β-strand	275-280	6	7
α-helix	282-287	6
α-helix	294-297	4
β-strand	301-310	10	9
β-strand	316-325	10	9
β-strand	326-327	2	8
β-strand	332-334	3	10
β-strand	341-342	2	11
β-strand	348-355	8	10
α-helix	360	1
β-strand	361	1	10
α-helix	362	1
β-strand	366-369	4	12
β-strand	377-378	2	12
β-strand	384-389	6	10
β-strand	398-404	7	12
α-helix	411-413	3
β-strand	417-421	5	12
β-strand	422-423	2	11
α-helix	424-426	3
α-helix	427-429	3
β-strand	433-437	5	13
β-strand	448-456	9	13
α-helix	462-464	3
β-strand	467-474	8	14
β-strand	477-485	9	14
β-strand	492-498	7	13
α-helix	499	1
α-helix	501-503	3
β-strand	506-516	11	14
β-strand	522-532	11	14
β-strand	541-545	5	15
β-strand	558-566	9	15
β-strand	570-577	8	16
α-helix	580-583	4
α-helix	591-600	10
β-strand	608	1	14
α-helix	613-619	7
β-strand	622	1	2
β-strand	625-626	2	1
β-strand	631	1	1
α-helix	632-635	4

Chain B: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	736-738	3
β-strand	742	1	17
β-strand	748-749	2	16
β-strand	753-755	3	16
β-strand	761	1	15
β-strand	764-772	9	15
β-strand	778-788	11	16
β-strand	792-795	4	16
α-helix	796-798	3
β-strand	799-803	5	16
β-strand	807-812	6	18
β-strand	816-818	3	17
β-strand	823-831	9	18
β-strand	838-844	7	17
α-helix	845-846	2
β-strand	850-851	2	19
β-strand	860-866	7	17
β-strand	870-878	9	18
β-strand	879-880	2	19
β-strand	884-894	11	17
β-strand	900-910	11	17

Chain C: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	1339-1347	9	20
β-strand	1362-1370	9	20
β-strand	1376	1	21
β-strand	1379-1384	6	22
α-helix	1385-1386	2
β-strand	1389-1391	3	20
α-helix	1393-1400	8
β-strand	1405-1406	2	22
α-helix	1409-1412	4
β-strand	1421-1426	6	22
β-strand	1429	1	21
β-strand	1435-1443	9	20
α-helix	1450-1452	3
β-strand	1453-1459	7	22
β-strand	1466-1471	6	22
α-helix	1476-1478	3
α-helix	1479-1481	3
β-strand	1482-1485	4	23
β-strand	1488-1491	4	23
α-helix	1507-1514	8
β-strand	1519-1531	13	24
β-strand	1536-1548	13	24
β-strand	1559-1565	7	24
α-helix	1566-1568	3
α-helix	1569-1572	4
β-strand	1579-1585	7	24
α-helix	1586-1588	3
β-strand	1589-1590	2	24
β-strand	1597-1599	3	24
β-strand	1605-1609	5	24
α-helix	1621-1637	17

Chain D: 17 helices, 56 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	25
β-strand	11-13	3	26
β-strand	14	1	27
β-strand	18-19	2	28
β-strand	21-25	5	25
β-strand	31-39	9	26
β-strand	47	1	26
β-strand	51-54	4	26
α-helix	56-58	3
β-strand	61-62	2	25
β-strand	65-66	2	28
β-strand	68	1	27
β-strand	83-90	8	26
β-strand	93-102	10	26
β-strand	107-112	6	29
β-strand	116-117	2	30
β-strand	122-130	9	29
β-strand	136	1	29
β-strand	140-146	7	30
β-strand	152-159	8	30
β-strand	166-172	7	29
β-strand	180-188	9	30
β-strand	196-202	7	30
β-strand	210-216	7	31
β-strand	221-222	2	32
β-strand	229-237	9	31
α-helix	241	1
β-strand	242	1	31
α-helix	243-244	2
β-strand	245-255	11	33
β-strand	258-271	14	33
β-strand	272	1	31
β-strand	275-280	6	31
α-helix	282-287	6
α-helix	294-297	4
β-strand	301-310	10	33
β-strand	316-325	10	33
β-strand	326-327	2	32
β-strand	332-334	3	34
β-strand	341-342	2	35
β-strand	347-355	9	34
α-helix	360	1
β-strand	361	1	34
α-helix	362	1
β-strand	366-369	4	36
β-strand	377-378	2	36
β-strand	384-390	7	34
α-helix	397	1
β-strand	398-404	7	36
β-strand	416-421	6	36
β-strand	422-423	2	35
α-helix	424-426	3
β-strand	433-437	5	37
β-strand	448-456	9	37
α-helix	462-464	3
β-strand	467-474	8	38
β-strand	477-485	9	38
β-strand	492-498	7	37
α-helix	499	1
α-helix	501-503	3
β-strand	506-516	11	38
β-strand	522-532	11	38
β-strand	542-545	4	39
β-strand	558-565	8	39
β-strand	570-577	8	40
α-helix	579-583	5
α-helix	591-600	10
β-strand	608	1	38
α-helix	613-619	7
β-strand	622-626	5	25
β-strand	631	1	25
α-helix	632-634	3
α-helix	640-642	3

Chain E: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	736-738	3
α-helix	739-741	3
β-strand	742	1	41
β-strand	748-749	2	40
β-strand	753-755	3	40
β-strand	761	1	42
β-strand	764	1	42
β-strand	765-772	8	39
β-strand	779-788	10	40
β-strand	792-795	4	40
α-helix	796-798	3
β-strand	799-802	4	40
β-strand	807-812	6	43
β-strand	816-818	3	41
β-strand	823-831	9	43
β-strand	838-844	7	41
α-helix	845-846	2
β-strand	850-851	2	44
β-strand	855	1	45
β-strand	858	1	45
β-strand	860-866	7	41
β-strand	871-878	8	43
β-strand	879-880	2	44
β-strand	884-894	11	41
β-strand	900-910	11	41

Chain F: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	1339-1347	9	46
β-strand	1362-1370	9	46
β-strand	1376	1	47
β-strand	1379-1384	6	48
α-helix	1385-1386	2
β-strand	1389-1391	3	46
α-helix	1393-1401	9
β-strand	1405-1406	2	48
α-helix	1409-1412	4
α-helix	1416-1418	3
β-strand	1421-1426	6	48
β-strand	1429	1	47
β-strand	1435-1443	9	46
α-helix	1450-1452	3
β-strand	1453-1459	7	48
β-strand	1467-1471	5	48
α-helix	1476-1478	3
α-helix	1479-1481	3
β-strand	1482-1485	4	49
β-strand	1488-1491	4	49
α-helix	1507-1513	7
β-strand	1519-1531	13	50
β-strand	1536-1548	13	50
α-helix	1554-1555	2
β-strand	1559-1565	7	50
α-helix	1566-1568	3
α-helix	1569-1572	4
β-strand	1579-1585	7	50
α-helix	1586-1588	3
β-strand	1589-1590	2	50
β-strand	1597-1599	3	50
β-strand	1605-1609	5	50
α-helix	1614-1616	3
α-helix	1621-1637	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement Component C3c	A, D	protein	643	Homo sapiens	P01024 (AlphaFold model)
Complement Component C3c	B, E	protein	188	Homo sapiens	P01024 (AlphaFold model)
Complement Component C3c	C, F	protein	343	Homo sapiens	P01024 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>2A74_1 Complement Component C3c (chains A, D)
SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNH
MGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPG
STVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMG
QWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYG
KKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNLRAEDLVGK
SLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGS
PAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQ
ALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLK
AGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGS
LVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEK
ADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQP

Sequence of entity 2 (B, E), FASTA

>2A74_2 Complement Component C3c (chains B, E)
SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVS
MSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLH
NPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKS
LKVVPEGI

Sequence of entity 3 (C, F), FASTA

>2A74_3 Complement Component C3c (chains C, F)
SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDA
KNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSD
RNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDE
YIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSY
IIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN

Primary citation

Structures of complement component C3 provide insights into the function and evolution of immunity. Janssen, B.J., Huizinga, E.G., Raaijmakers, H.C. et al. Nature (2005) 437:505-511. DOI 10.1038/nature04005 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex

Browse structure collections

About this viewer

MolViewer shows 2A74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.