2A7B: Gamma-adaptin appendage domain

On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength. Determined by X-ray diffraction at 1.65 Å resolution. Released 19 Jul 2005.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,036
Mol. weight: 13.68 kDa
Ligands: XE
Released: 19 Jul 2005

Explore 2A7B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A7B contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	704-706	3
β-strand	707-712	6	1
β-strand	715-723	9	1
β-strand	730-739	10	1
β-strand	745	1	2
β-strand	746-753	8	3
β-strand	759-762	4	1
α-helix	763-765	3
β-strand	770	1	2
α-helix	772-774	3
β-strand	778-785	8	1
α-helix	790-792	3
β-strand	794-802	9	3
β-strand	805-813	9	3
α-helix	818-820	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
gamma-adaptin appendage domain	A	protein	120	Mus musculus	P22892 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2A7B_1 gamma-adaptin appendage domain (chains A)
MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQL
LSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ

Ligands and cofactors

ID	Name	Formula	Copies
XE	Xenon	Xe	2

Primary citation

On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength. Mueller-Dieckmann, C., Panjikar, S., Tucker, P.A. et al. Acta Crystallogr D Biol Crystallogr (2005) 61:1263-1272. DOI 10.1107/S0907444905021475 · PubMed

Other PDB entries of the same protein (UniProt P22892 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZY7 1.09 Å, Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a…
1GYV 1.71 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1, L762E mutant
1GYU 1.81 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1
7R4H 2.34 Å, phospho-STING binding to adaptor protein complex-1
1GYW 2.4 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1 A753D mutant
4P6Z 3.0 Å, Crystal structure of the human BST2 cytoplasmic domain and the HIV-1 Vpu cytoplasmic…
6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit
6DFF 3.9 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef monomer
1W63 4.0 Å, AP1 clathrin adaptor core
6D83 4.27 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant…
6D84 6.72 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer
6CRI 6.8 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef stable closed trimer

Browse structure collections

About this viewer

MolViewer shows 2A7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.