3ZY7: Ap-1 complex subunit gamma-1

Crystal structure of computationally redesigned gamma-adaptin appendage domain forming a symmetric homodimer. Determined by X-ray diffraction at 1.09 Å resolution. Released 28 Dec 2011.

Method: X-ray diffraction
Resolution: 1.09 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 2,423
Mol. weight: 27.61 kDa
Ligands: IPA
Released: 28 Dec 2011

Explore 3ZY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZY7 contains 8 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-10	6	1
β-strand	13-20	8	1
β-strand	28-37	10	1
β-strand	43-51	9	2
β-strand	57-60	4	1
β-strand	67-68	2	2
α-helix	70-72	3
β-strand	76-83	8	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	103-111	9	2
α-helix	116-118	3

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-10	6	3
β-strand	13-20	8	3
β-strand	28-37	10	3
β-strand	43	1	4
β-strand	44-51	8	2
β-strand	57-60	4	3
β-strand	68	1	4
α-helix	70-72	3
β-strand	76-83	8	3
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	103-111	9	2
α-helix	116-118	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ap-1 complex subunit gamma-1	A, B	protein	122	MUS MUSCULUS	P22892 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ZY7_1 AP-1 COMPLEX SUBUNIT GAMMA-1 (chains A, B)
GSMIPSITAYDALGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQL
QLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTFNWNGYKVQSEAEVNNFPPQS
WQ

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	2

Water and common crystallization additives (PEG) are not listed.

Primary citation

Computational Design of a Symmetric Homodimer Using Beta-Strand Assembly. Stranges, P.B., Machius, M., Miley, M.J. et al. Proc Natl Acad Sci U S A (2011) 108:20562. DOI 10.1073/PNAS.1115124108 · PubMed

Other PDB entries of the same protein (UniProt P22892 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A7B 1.65 Å, On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The…
1GYV 1.71 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1, L762E mutant
1GYU 1.81 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1
7R4H 2.34 Å, phospho-STING binding to adaptor protein complex-1
1GYW 2.4 Å, Gamma-adaptin appendage domain from clathrin adaptor AP1 A753D mutant
4P6Z 3.0 Å, Crystal structure of the human BST2 cytoplasmic domain and the HIV-1 Vpu cytoplasmic…
6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit
6DFF 3.9 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef monomer
1W63 4.0 Å, AP1 clathrin adaptor core
6D83 4.27 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant…
6D84 6.72 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer
6CRI 6.8 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef stable closed trimer

Browse structure collections

About this viewer

MolViewer shows 3ZY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.