2A91: ErbB2 domains 1-3

Crystal structure of ErbB2 domains 1-3. Determined by X-ray diffraction at 2.5 Å resolution. Released 26 Jul 2005.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,042
Mol. weight: 57.86 kDa
Ligands: NAG
Released: 26 Jul 2005

Explore 2A91 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A91 contains 20 α-helices and 50 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 50 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	8	1	2
α-helix	13-15	3
α-helix	18-29	12
β-strand	34-36	3	1
β-strand	38	1	2
β-strand	39-42	4	3
α-helix	51-53	3
β-strand	58-59	2	1
β-strand	63-66	4	3
β-strand	80-81	2	1
β-strand	87	1	3
β-strand	91-96	6	3
β-strand	118	1	4
β-strand	126-127	2	1
β-strand	131-135	5	3
β-strand	141	1	4
α-helix	148-151	4
β-strand	152	1	1
β-strand	161-163	3	3
α-helix	170-175	6
β-strand	183	1	5
β-strand	191	1	5
α-helix	192-194	3
β-strand	206	1	6
α-helix	211-213	3
β-strand	214	1	6
α-helix	215-216	2
β-strand	219-223	5	7
β-strand	231-234	4	7
β-strand	237-239	3	8
β-strand	242-244	3	8
α-helix	247-249	3
β-strand	251-253	3	9
β-strand	260-262	3	9
β-strand	268-270	3	8
β-strand	273-275	3	8
α-helix	278-279	2
β-strand	283-284	2	10
β-strand	289	1	8
β-strand	290-291	2	10
β-strand	299-302	4	10
β-strand	308-311	4	10
β-strand	321-322	2	11
β-strand	324	1	12
α-helix	327-331	5
α-helix	340-343	4
β-strand	348-350	3	11
β-strand	352	1	12
β-strand	353-355	3	13
α-helix	357-361	5
β-strand	363	1	14
α-helix	364-366	3
β-strand	368	1	14
α-helix	369-372	4
α-helix	375-381	7
β-strand	384-385	2	11
β-strand	389-391	3	13
α-helix	402-404	3
β-strand	409-410	2	11
β-strand	416	1	13
β-strand	420-425	6	13
β-strand	439-440	2	11
β-strand	444-448	5	13
α-helix	461-464	4
β-strand	472-475	4	13
α-helix	480-485	6
β-strand	499	1	15
α-helix	504-506	3
β-strand	507	1	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor tyrosine-protein kinase erbB-2	A	protein	517	Homo sapiens	P04626 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2A91_1 Receptor tyrosine-protein kinase erbB-2 (chains A)
STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQ
GYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQ
LRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKG
SRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHS
GICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQE
VTAEDGTQKCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESF
DGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAY
SLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPE
DECVGEGLACHQLCAKGHCWGPGPTQCVNDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

The Crystal Structure of a Truncated ErbB2 Ectodomain Reveals an Active Conformation, Poised to Interact with Other ErbB Receptors. Garrett, T.P.J., McKern, N.M., Lou, M. et al. Mol Cell (2003) 11:495-505. DOI 10.1016/S1097-2765(03)00048-0 · PubMed

Other PDB entries of the same protein (UniProt P04626 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
8VB5 1.48 Å, Crystal structure of kinase domain of HER2 Exon 20 insertion mutant in complex with…
8JYR 1.69 Å, Crystal structure of anti-HER2 antibody H2Mab-119 in complex with HER2 domain I
8U8X 1.69 Å, crystal structure of the receptor tyrosine kinase Human HER2 (ERBB2) YVMA mutant kinase…
8JYQ 1.75 Å, Crystal structure of cancer-specific anti-HER2 antibody H2Mab-214 in complex with…
7PCD 1.77 Å, HER2 in complex with a covalent inhibitor
5TQS 1.88 Å, Phospholipase C gamma-1 C-terminal SH2 domain bound to a phosphopeptide derived from the…
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
4GFU 2.0 Å, PTPN18 in complex with HER2-pY1248 phosphor-peptides
6LBX 2.03 Å, Crystal structure of HER2 Domain IV and Rb-H2
9IUT 2.09 Å, Crystal structure of cancer-specific anti-HER2 antibody H2Mab-250 in complex with…
5MY6 2.25 Å, Crystal structure of a HER2-Nb complex

Browse structure collections

About this viewer

MolViewer shows 2A91 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.