The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor. Determined by X-ray diffraction at 1.25 Å resolution. Released 21 Jan 2003.
Explore 1MFG in 3D Show helices and sheets RCSB PDB PDBe
1MFG contains 2 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1278-1286 | 9 | 1 |
| β-strand | 1293-1297 | 5 | 1 |
| β-strand | 1299 | 1 | 2 |
| β-strand | 1313-1318 | 6 | 1 |
| α-helix | 1332 | 1 | |
| β-strand | 1333-1337 | 5 | 1 |
| β-strand | 1340-1341 | 2 | 1 |
| β-strand | 1346 | 1 | 2 |
| α-helix | 1347-1356 | 10 | |
| β-strand | 1360-1368 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1253-1254 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Erb-B2 interacting protein | A | protein | 95 | Homo sapiens | Q96RT1 (AlphaFold model) |
| Erb-B2 carboxyl-terminal fragment | B | protein | 9 | P04626 (AlphaFold model) |
>1MFG_1 Erb-B2 INTERACTING PROTEIN (chains A) GSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQ ANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
>1MFG_2 Erb-B2 carboxyl-terminal fragment (chains B) EYLGLDVPV
Novel mode of ligand recognition by the erbin PDZ domain. Birrane, G., Chung, J., Ladias, J.A. J Biol Chem (2003) 278:1399-1402. DOI 10.1074/jbc.C200571200 · PubMed
Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.