2AF0: Regulator of G-Protein Signaling Domain of RGS2

Structure of the Regulator of G-Protein Signaling Domain of RGS2. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Aug 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,166
Mol. weight: 16.99 kDa
Released: 2 Aug 2005

Explore 2AF0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AF0 contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	62-69	8
α-helix	72-73	2
α-helix	74-79	6
α-helix	84-89	6
α-helix	91-103	13
α-helix	108-120	13
α-helix	125-135	11
α-helix	136-140	5
α-helix	152-161	10
α-helix	162-164	3
α-helix	171-180	10
α-helix	181-185	5
α-helix	186-191	6
α-helix	193-199	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of G-protein signaling 2	A	protein	146	Homo sapiens	P41220 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AF0_1 Regulator of G-protein signaling 2 (chains A)
ADLGTENLYFQSMKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACE
DFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRV
YSLMENNSYPRFLESEFYQDLCKKPQ

Primary citation

Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits. Soundararajan, M., Willard, F.S., Kimple, A.J. et al. Proc Natl Acad Sci U S A (2008) 105:6457-6462. DOI 10.1073/pnas.0801508105 · PubMed

Other PDB entries of the same protein (UniProt P41220 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EKD 2.71 Å, Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine…
2V4Z 2.8 Å, The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an…
4EKC 7.4 Å, Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine…

Browse structure collections

About this viewer

MolViewer shows 2AF0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.