2V4Z: Human G-protein subunit alpha

The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an engineered regulator of G-protein signaling type 2 domain (RGS2). Determined by X-ray diffraction at 2.8 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,448
Mol. weight: 57.19 kDa
Ligands: GDP, ALF, MG
Released: 4 Nov 2008

Explore 2V4Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V4Z contains 28 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	33-39	7	1
α-helix	46-57	12
α-helix	63-68	6
α-helix	70-91	22
α-helix	100-113	14
α-helix	121-132	12
α-helix	134-141	8
α-helix	143-145	3
α-helix	152-156	5
α-helix	159-162	4
α-helix	171-176	6
β-strand	184-190	7	1
β-strand	195-201	7	1
α-helix	205-214	10
β-strand	220-226	7	1
α-helix	227-231	5
β-strand	233	1	2
β-strand	241	1	2
α-helix	242-254	13
α-helix	257-259	3
β-strand	263-269	7	1
α-helix	271-277	7
α-helix	283-285	3
α-helix	296-308	13
β-strand	319-323	5	1
α-helix	329-345	17

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	75-79	5
α-helix	84-89	6
α-helix	91-103	13
α-helix	108-119	12
α-helix	125-139	15
α-helix	152-160	9
α-helix	171-180	10
α-helix	181-185	5
α-helix	186-191	6
α-helix	193-198	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein g(k) subunit alpha	A	protein	350	HOMO SAPIENS	P08754 (AlphaFold model)
Regulator of G-protein signaling 2	B	protein	142	HOMO SAPIENS	P41220 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2V4Z_1 GUANINE NUCLEOTIDE-BINDING PROTEIN G(K) SUBUNIT ALPHA (chains A)
SMTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGY
SEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTP
ELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKT
TGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAA
YIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKES

Sequence of entity 2 (B), FASTA

>2V4Z_2 REGULATOR OF G-PROTEIN SIGNALING 2 (chains B)
SNAKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFSEENIEFWLACEDFKKTKSPQK
LSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENDSYP
RFLKSEFYQDLCKKPQITTEPH

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
ALF	Tetrafluoroaluminate ion	Al F4	1
MG	Magnesium ion	Mg	1

Primary citation

Structural Determinants of G-Protein Alpha Subunit Selectivity by Regulator of G-Protein Signaling 2(Rgs2). Kimple, A.J., Soundararajan, M., Hutsell, S.Q. et al. J Biol Chem (2009) 284:19402. DOI 10.1074/JBC.M109.024711 · PubMed

Other PDB entries of the same protein (UniProt P08754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ODE 1.9 Å, Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3
9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
8IKL 2.33 Å, Cryo-EM structure of the CD97-G13 complex
8YK0 2.4 Å, Cryo-EM structure of human GPR156-Gi3 complex
7T10 2.5 Å, CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
9VJ6 2.62 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with F-15599
7T11 2.7 Å, CryoEM structure of somatostatin receptor 2 in complex with Octreotide and Gi3.
9VJF 2.7 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with buspirone
2IHB 2.71 Å, Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
4G5O 2.9 Å, Structure of LGN GL4/Galphai3(Q147L) complex

Browse structure collections

About this viewer

MolViewer shows 2V4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.