De-ubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain. Determined by solution NMR. Released 30 Aug 2005.
Explore 2AGA in 3D Show helices and sheets RCSB PDB PDBe
2AGA contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| α-helix | 21-27 | 7 | |
| α-helix | 35-56 | 22 | |
| α-helix | 61-67 | 7 | |
| α-helix | 83-92 | 10 | |
| β-strand | 95-98 | 4 | 1 |
| α-helix | 102-108 | 7 | |
| β-strand | 116-120 | 5 | 1 |
| β-strand | 125-131 | 7 | 1 |
| β-strand | 134-138 | 5 | 1 |
| β-strand | 146-148 | 3 | 1 |
| α-helix | 150-163 | 14 | |
| β-strand | 167-171 | 5 | 1 |
| α-helix | 178-183 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Machado-Joseph disease protein 1 | A | protein | 190 | Homo sapiens | P54252 (AlphaFold model) |
>2AGA_1 Machado-Joseph disease protein 1 (chains A) GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTS EDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICN YKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEAD QLLQMIRVQQ
Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain. Mao, Y., Senic-Matuglia, F., Di Fiore, P.P. et al. Proc Natl Acad Sci U S A (2005) 102:12700-12705. DOI 10.1073/pnas.0506344102 · PubMed
Other PDB entries of the same protein (UniProt P54252 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.