2AI0: Anti-Cocaine Antibody 7.5.21, Crystal Form III

Anti-Cocaine Antibody 7.5.21, Crystal Form III. Determined by X-ray diffraction at 2.2 Å resolution. Released 9 Aug 2005.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 8
Atoms: 14,074
Mol. weight: 195.69 kDa
Released: 9 Aug 2005

Explore 2AI0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AI0 contains 61 α-helices and 182 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	58-59	2	2
β-strand	68-73	6	7
α-helix	74-76	3
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	112-113	2	2
β-strand	117-119	3	2
β-strand	120-121	2	8
α-helix	125-126	2
β-strand	127	1	9
α-helix	128-129	2
β-strand	130-134	5	10
β-strand	145-155	11	10
β-strand	156	1	9
β-strand	161-164	4	11
α-helix	165-167	3
β-strand	173-175	3	10
α-helix	176-178	3
β-strand	179-181	3	10
β-strand	184-194	11	10
β-strand	204-209	6	11
α-helix	210-212	3
β-strand	214-219	6	11

Chain I: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	18
β-strand	11-12	2	19
β-strand	18-25	8	18
α-helix	29-31	3
β-strand	33-39	7	20
β-strand	45-51	7	20
β-strand	58-59	2	20
β-strand	68-73	6	18
β-strand	78-83	6	18
α-helix	88-90	3
β-strand	92-99	8	20
β-strand	112-113	2	20
β-strand	117-119	3	20
β-strand	120-121	2	19
α-helix	124-126	3
β-strand	127	1	21
α-helix	128-129	2
β-strand	130-134	5	22
β-strand	145-155	11	22
β-strand	156	1	21
β-strand	161-164	4	23
α-helix	165-167	3
β-strand	169	1	23
β-strand	173-175	3	22
α-helix	176-178	3
β-strand	179-180	2	22
β-strand	185-194	10	22
β-strand	204-209	6	23
α-helix	210-212	3
β-strand	214-219	6	23

Chain J: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	30
β-strand	11-12	2	31
β-strand	17-25	9	30
α-helix	29-31	3
β-strand	33-39	7	32
β-strand	45-51	7	32
β-strand	58-59	2	32
α-helix	62-64	3
β-strand	68-73	6	30
β-strand	78-84	7	30
α-helix	88-90	3
β-strand	92-101	10	32
β-strand	104-113	10	32
β-strand	117-119	3	32
β-strand	120-121	2	31
α-helix	124-126	3
β-strand	127	1	33
α-helix	128-129	2
β-strand	130-134	5	34
β-strand	145-155	11	34
β-strand	156	1	33
β-strand	161-164	4	35
α-helix	165-167	3
β-strand	173-175	3	34
α-helix	176-178	3
β-strand	179-181	3	34
β-strand	184-194	11	34
β-strand	204-209	6	35
α-helix	210-212	3
β-strand	214-219	6	35

Chain K: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	42
β-strand	10-12	3	43
β-strand	18-25	8	42
α-helix	29-31	3
β-strand	34-39	6	43
β-strand	45-51	7	43
β-strand	58-59	2	43
β-strand	69-73	5	42
α-helix	74-76	3
β-strand	78-83	6	42
α-helix	88-90	3
β-strand	92-99	8	43
β-strand	110-113	4	43
β-strand	117-121	5	43
α-helix	125-126	2
β-strand	127	1	44
α-helix	128-129	2
β-strand	130-134	5	45
α-helix	140-141	2
β-strand	145-155	11	45
β-strand	156	1	44
β-strand	161-164	4	23
α-helix	165-167	3
β-strand	169	1	23
β-strand	173-175	3	45
α-helix	176-178	3
β-strand	179-181	3	45
β-strand	184-194	11	45
β-strand	204-209	6	23
α-helix	210-212	3
β-strand	214-219	6	23

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-71	5	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-160	3	6
β-strand	164-168	5	5
β-strand	178-187	10	5
α-helix	188-192	5
β-strand	196-202	7	6
β-strand	210-215	6	6

Chain M: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	30	1	14
β-strand	36	1	14
β-strand	38-43	6	13
β-strand	50-54	5	13
β-strand	58-59	2	13
α-helix	60	1
β-strand	67-72	6	12
β-strand	75-80	6	12
α-helix	85-87	3
β-strand	89-95	7	13
α-helix	101	1
β-strand	102-103	2	13
β-strand	104	1	12
β-strand	107-111	5	13
β-strand	116	1	15
α-helix	117-118	2
β-strand	119-123	5	16
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	16
β-strand	145	1	15
β-strand	150-155	6	17
β-strand	158-159	2	17
β-strand	164-168	5	16
α-helix	169-172	4
β-strand	178-187	10	16
α-helix	188-192	5
β-strand	196-202	7	17
β-strand	210-215	6	17

Chain N: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	24
β-strand	10-13	4	25
β-strand	19-25	7	24
β-strand	30	1	26
α-helix	31	1
β-strand	36	1	26
β-strand	38-43	6	25
β-strand	50-54	5	25
β-strand	58-59	2	25
β-strand	67-72	6	24
β-strand	75-80	6	24
α-helix	85-87	3
β-strand	89-95	7	25
β-strand	102-103	2	25
β-strand	107-111	5	25
β-strand	116	1	27
β-strand	119-123	5	28
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	28
β-strand	145	1	27
β-strand	150-155	6	29
β-strand	158-160	3	29
β-strand	164-168	5	28
α-helix	169-172	4
β-strand	178-187	10	28
α-helix	188-192	5
β-strand	196-202	7	29
β-strand	210-215	6	29

Chain O: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	36
β-strand	10-13	4	37
β-strand	19-25	7	36
β-strand	30	1	38
β-strand	36	1	38
β-strand	38-43	6	37
β-strand	50-54	5	37
β-strand	58-59	2	37
α-helix	60	1
β-strand	67-72	6	36
β-strand	75-80	6	36
α-helix	85-87	3
β-strand	89-95	7	37
α-helix	101	1
β-strand	102-103	2	37
β-strand	107-111	5	37
β-strand	116	1	39
α-helix	117-118	2
β-strand	119-123	5	40
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	40
β-strand	145	1	39
β-strand	150-155	6	41
β-strand	158-160	3	41
β-strand	164-168	5	40
α-helix	169-172	4
β-strand	178-187	10	40
α-helix	188-193	6
β-strand	196-202	7	41
β-strand	210-215	6	41

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin Light Chain kappa	L, M, N, O	protein	217	Mus musculus
Immunoglobulin Heavy Chain	H, I, J, K	protein	224	Mus musculus	Q6PIP8 (AlphaFold model)

Sequence of entity 1 (L, M, N, O), FASTA

>2AI0_1 Immunoglobulin Light Chain kappa (chains L, M, N, O)
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGRSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Sequence of entity 2 (H, I, J, K), FASTA

>2AI0_2 Immunoglobulin Heavy Chain (chains H, I, J, K)
DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSY
PDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYYGKSPYFFDVWGAGTTVT
ASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVL
QSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

Primary citation

Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21. Pozharski, E., Hewagama, A., Shanafelt, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q6PIP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R2H 2.0 Å, Structure of S25-2 in Complex with Ko
4PB0 2.5 Å, Structure of the Fab fragment of the anti-Francisella tularensis GroEL antibody Ab53

Browse structure collections

About this viewer

MolViewer shows 2AI0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.