2AJ3: Fab m18, Light Chain

Crystal Structure of a Cross-Reactive HIV-1 Neutralizing CD4-Binding Site Antibody Fab m18. Determined by X-ray diffraction at 2.03 Å resolution. Released 28 Mar 2006.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 6
Atoms: 10,497
Mol. weight: 143.88 kDa
Released: 28 Mar 2006

Explore 2AJ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AJ3 contains 52 α-helices and 140 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	98	1	2
β-strand	102-106	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-154	2	5
α-helix	155	1
β-strand	159-163	5	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-197	7	5
β-strand	205-210	6	5

Chain B: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	41	1	9
β-strand	43	1	9
β-strand	46-51	6	8
β-strand	59	1	8
α-helix	64-66	3
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-98	11	8
β-strand	100B-103	8	8
β-strand	107-109	3	8
β-strand	110-111	2	7
α-helix	114-116	3
β-strand	117	1	10
β-strand	120-124	5	11
α-helix	128-130	3
β-strand	131-132	2	11
β-strand	135-145	11	11
β-strand	146	1	10
β-strand	151-154	4	12
α-helix	155-157	3
β-strand	159	1	12
β-strand	163-165	3	11
α-helix	166-168	3
β-strand	169-170	2	11
β-strand	176-185	10	11
α-helix	186-189	4
β-strand	195-200	6	12
α-helix	201-203	3
β-strand	205-210	6	12

Chain C: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	13
β-strand	10-13	4	14
β-strand	18-25	8	13
β-strand	33-38	6	14
α-helix	43-44	2
β-strand	45-49	5	14
β-strand	53-54	2	14
α-helix	55	1
β-strand	62-67	6	13
β-strand	70-76	7	13
α-helix	80-82	3
β-strand	85-90	6	14
α-helix	96	1
β-strand	97-98	2	14
β-strand	102-106	5	14
β-strand	111	1	15
α-helix	112-113	2
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	16
β-strand	140	1	15
β-strand	145-150	6	17
β-strand	153-154	2	17
β-strand	159-163	5	16
β-strand	173-182	10	16
α-helix	183-186	4
β-strand	191-197	7	17
β-strand	205-210	6	17

Chain D: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	18
β-strand	11-12	2	19
α-helix	17	1
β-strand	18-25	8	18
α-helix	29-31	3
β-strand	33-39	7	20
β-strand	46-51	6	20
β-strand	59	1	20
α-helix	61-64	4
β-strand	69-72	4	18
β-strand	77-82	6	18
α-helix	84-86	3
β-strand	88-98	11	20
β-strand	100B-103	8	20
β-strand	107-109	3	20
β-strand	110-111	2	19
α-helix	114-116	3
β-strand	117	1	21
α-helix	118-119	2
β-strand	120-124	5	22
β-strand	131-132	2	22
β-strand	135-145	11	22
β-strand	146	1	21
β-strand	151-154	4	23
α-helix	155-157	3
β-strand	159	1	23
β-strand	163-165	3	22
α-helix	166-168	3
β-strand	169-170	2	22
β-strand	176-185	10	22
α-helix	188-191	4
β-strand	194-200	7	23
α-helix	201-203	3
β-strand	205-211	7	23

Chain E: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	24
β-strand	10-13	4	25
β-strand	18-25	8	24
β-strand	33-38	6	25
β-strand	45-49	5	25
β-strand	53-54	2	25
α-helix	55	1
β-strand	62-67	6	24
β-strand	70-76	7	24
α-helix	80-82	3
β-strand	85-90	6	25
α-helix	96	1
β-strand	97	1	26
β-strand	98	1	25
β-strand	102-106	5	25
β-strand	111	1	27
α-helix	112-113	2
β-strand	114-118	5	28
α-helix	119-121	3
α-helix	124-126	3
β-strand	129-139	11	28
β-strand	140	1	27
β-strand	145-150	6	29
β-strand	153-154	2	29
α-helix	155	1
β-strand	159-163	5	28
α-helix	164-167	4
β-strand	173-182	10	28
α-helix	183-188	6
β-strand	191-197	7	29
β-strand	205-210	6	29

Chain F: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	30
β-strand	6-7	2	31
β-strand	11-12	2	32
β-strand	18-23	6	31
β-strand	25	1	30
α-helix	29-31	3
β-strand	34-39	6	26
β-strand	46-51	6	26
β-strand	59	1	26
α-helix	64-66	3
β-strand	67-72	6	31
α-helix	73-75	3
β-strand	77-82	6	31
α-helix	84-86	3
β-strand	88-98	11	26
β-strand	100B-103	8	26
β-strand	107-109	3	26
β-strand	110-111	2	32
α-helix	114-116	3
β-strand	117	1	33
α-helix	118-119	2
β-strand	120-124	5	34
β-strand	131-132	2	34
β-strand	135-145	11	34
β-strand	146	1	33
β-strand	151-154	4	35
β-strand	159	1	35
β-strand	163-165	3	34
α-helix	166-168	3
β-strand	169-170	2	34
β-strand	176-185	10	34
α-helix	186-190	5
β-strand	195-200	6	35
α-helix	201-203	3
β-strand	205-210	6	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab m18, Light Chain	A, C, E	protein	213	Homo sapiens	Q6PIH7
Fab m18, Heavy Chain	B, D, F	protein	228	Homo sapiens	Q6GMX1

Sequence of entity 1 (A, C, E), FASTA

>2AJ3_1 Fab m18, Light Chain (chains A, C, E)
LQMTQSPSFLSASVGDRVSITCRASQDIQKFLAWYQLTPGDAPKLLMYSASTLQSGVPSR
FSGSGSGTEFTLTISGLQPEDFATYYCQHLKRYPYTFGQGTKLEISRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDNKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (B, D, F), FASTA

>2AJ3_2 Fab m18, Heavy Chain (chains B, D, F)
VQLLESGPGVVKPSETLSLTCTVSGASVNNYYWTWVRQPPGKGLEWIGNVYDSGDTNYNP
SLSSRLSLSMDTSKNQFSLRLSSVTAADTATYYCARYHRHFIRGPLSFDYWGRGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTS

Primary citation

Structural mimicry of CD4 by a cross-reactive HIV-1 neutralizing antibody with CDR-H2 and H3 containing unique motifs. Prabakaran, P., Gan, J., Wu, Y.Q. et al. J Mol Biol (2006) 357:82-99. DOI 10.1016/j.jmb.2005.12.062 · PubMed

Other PDB entries of the same protein (UniProt Q6PIH7), best resolution first:

2HFG 2.61 Å, Crystal structure of hBR3 bound to CB3s-Fab

Browse structure collections

About this viewer

MolViewer shows 2AJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.