2AJU: Antibody 7A1 FAB'

Cyrstal structure of cocaine catalytic antibody 7A1 Fab'. Determined by X-ray diffraction at 1.5 Å resolution. Released 14 Feb 2006.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,889
Mol. weight: 47.93 kDa
Released: 14 Feb 2006

Explore 2AJU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AJU contains 19 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
β-strand	34-39	7	10
β-strand	45-52	8	10
β-strand	56-59	4	10
α-helix	61-63	3
β-strand	67-72	6	8
α-helix	73-75	3
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-95	8	10
β-strand	103	1	10
β-strand	107-109	3	10
β-strand	110-111	2	9
α-helix	115-116	2
β-strand	117	1	11
α-helix	118-119	2
β-strand	120-124	5	12
β-strand	137-147	11	12
β-strand	148	1	11
β-strand	153-157	4	13
α-helix	162-164	3
β-strand	166	1	13
β-strand	171-173	3	12
α-helix	174-176	3
β-strand	177-179	3	12
β-strand	184-194	11	12
β-strand	207-212	6	13
α-helix	213-215	3
β-strand	217-222	6	13

Chain L: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	7-9	3
β-strand	13-14	2	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	4
β-strand	45-49	5	4
β-strand	53-54	2	4
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	4
α-helix	97	1
β-strand	98	1	4
α-helix	99	1
β-strand	102-104	3	4
β-strand	106-107	2	2
β-strand	111	1	5
α-helix	112-113	2
β-strand	114-118	5	6
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	6
β-strand	140	1	5
β-strand	145-150	6	7
β-strand	153-155	3	7
β-strand	159-163	5	6
α-helix	164-167	4
β-strand	173-182	10	6
α-helix	183-186	4
β-strand	191-197	7	7
α-helix	204	1
β-strand	205-210	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antibody 7A1 FAB'	L	protein	216	Mus musculus	P01837 (AlphaFold model)
Antibody 7A1 FAB'	H	protein	219	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>2AJU_1 ANTIBODY 7A1 FAB' (chains L)
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRA
SGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H), FASTA

>2AJU_2 ANTIBODY 7A1 FAB' (chains H)
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRY
NPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSA
KTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL
YTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR

Primary citation

Complete reaction cycle of a cocaine catalytic antibody at atomic resolution. Zhu, X., Dickerson, T.J., Rogers, C.J. et al. Structure (2006) 14:205-216. DOI 10.1016/j.str.2005.10.014 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…
2R23 1.65 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues

Browse structure collections

About this viewer

MolViewer shows 2AJU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.