2AJZ: Cocaine catalytic Antibody 7A1 Fab'

Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with ecgonine methyl ester. Determined by X-ray diffraction at 2.3 Å resolution. Released 14 Feb 2006.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 4
Atoms: 7,037
Mol. weight: 96.25 kDa
Ligands: ECG
Released: 14 Feb 2006

Explore 2AJZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AJZ contains 35 α-helices and 94 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	14
α-helix	7-9	3
α-helix	12	1
β-strand	13	1	15
α-helix	14	1
β-strand	19-25	7	14
β-strand	27C	1	16
β-strand	31	1	16
β-strand	33-38	6	17
β-strand	45-49	5	17
β-strand	53-54	2	17
α-helix	55	1
β-strand	62-66	5	14
β-strand	70-75	6	14
α-helix	80-82	3
β-strand	84-90	7	17
α-helix	97	1
β-strand	98	1	17
α-helix	99	1
β-strand	102-104	3	17
β-strand	106	1	15
β-strand	111	1	18
β-strand	114-118	5	19
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	19
β-strand	140	1	18
β-strand	145-150	6	20
β-strand	153-155	3	20
β-strand	159-163	5	19
α-helix	164-167	4
β-strand	173-182	10	19
α-helix	183-187	5
β-strand	191-197	7	20
α-helix	204	1
β-strand	205-210	6	20

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	21
β-strand	11-12	2	22
β-strand	18-25	8	21
β-strand	34-39	7	23
β-strand	45-52	8	23
β-strand	56-59	4	23
α-helix	61-63	3
β-strand	67-72	6	21
β-strand	77-82	6	21
α-helix	84-86	3
β-strand	88-95	8	23
β-strand	103	1	23
β-strand	107-109	3	23
β-strand	110-111	2	22
α-helix	115-116	2
β-strand	117	1	24
β-strand	120-124	5	25
β-strand	137-147	11	25
β-strand	148	1	24
β-strand	153-157	4	26
α-helix	162-164	3
β-strand	166	1	26
β-strand	171-173	3	25
α-helix	174-176	3
β-strand	177-178	2	25
β-strand	185-194	10	25
α-helix	195-199	3
β-strand	207-212	6	26
α-helix	213-215	3
β-strand	217-222	6	26

Chain H: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
β-strand	34-39	7	10
β-strand	45-52	8	10
β-strand	56-59	4	10
α-helix	61-63	3
β-strand	67-72	6	8
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-95	8	10
β-strand	103	1	10
β-strand	107-109	3	10
β-strand	110-111	2	9
α-helix	115-116	2
β-strand	117	1	11
β-strand	120-124	5	12
β-strand	137-147	11	12
β-strand	148	1	11
β-strand	153-157	4	13
α-helix	162-164	3
β-strand	166	1	13
β-strand	171-173	3	12
α-helix	174-176	3
β-strand	177	1	12
β-strand	185-194	10	12
α-helix	195-199	3
β-strand	207-212	6	13
α-helix	213-215	3
β-strand	217-222	6	13

Chain L: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	7-9	3
α-helix	12	1
β-strand	13-14	2	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	4
β-strand	45-49	5	4
β-strand	53-54	2	4
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	4
β-strand	98	1	4
β-strand	102-104	3	4
β-strand	106-107	2	2
β-strand	111	1	5
β-strand	114-118	5	6
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	6
β-strand	140	1	5
β-strand	145-150	6	7
β-strand	153-155	3	7
β-strand	159-163	5	6
α-helix	165-167	3
β-strand	173-182	10	6
α-helix	183-186	4
β-strand	191-197	7	7
α-helix	204	1
β-strand	205-210	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antibody 7A1 Fab'	A, L	protein	216	Mus musculus	P01837 (AlphaFold model)
Antibody 7A1 Fab'	B, H	protein	219	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>2AJZ_1 Antibody 7A1 Fab' (chains A, L)
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRA
SGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (B, H), FASTA

>2AJZ_2 Antibody 7A1 Fab' (chains B, H)
EVKLSESGPGLVKPSQSLSLTCTVTGYSITTNYAWTWIRQFPGNKLEWMGYIRSSVITRY
NPSLKSRISITQDTSKNQFFLQLNSVTTEDTATYYCARYDYYGNTGDYWGQGTSVTVSSA
KTTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL
YTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR

Ligands and cofactors

ID	Name	Formula	Copies
ECG	3-hydroxy-8-methyl-8-aza-BICYCLO[3.2.1]OCTANE-2-carboxylic acid methyl ester	C10 H17 N O3	2

Primary citation

Complete reaction cycle of a cocaine catalytic antibody at atomic resolution. Zhu, X., Dickerson, T.J., Rogers, C.J. et al. Structure (2006) 14:205-216. DOI 10.1016/j.str.2005.10.014 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 2AJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.