Structure Of Human ADP-Ribosylation Factor-Like 10C. Determined by X-ray diffraction at 1.85 Å resolution. Released 23 Aug 2005.
Explore 2AL7 in 3D Show helices and sheets RCSB PDB PDBe
2AL7 contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-25 | 8 | 1 |
| α-helix | 32-39 | 8 | |
| β-strand | 54-61 | 8 | 1 |
| β-strand | 64-71 | 8 | 1 |
| α-helix | 75-80 | 6 | |
| α-helix | 81-85 | 5 | |
| β-strand | 90-96 | 7 | 1 |
| α-helix | 100-102 | 3 | |
| α-helix | 103-114 | 12 | |
| α-helix | 117-119 | 3 | |
| β-strand | 124-129 | 6 | 1 |
| α-helix | 139-145 | 7 | |
| α-helix | 148-150 | 3 | |
| β-strand | 156-160 | 5 | 1 |
| β-strand | 162 | 1 | 2 |
| β-strand | 167 | 1 | 2 |
| α-helix | 169-177 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ADP-ribosylation factor-like 10C | A | protein | 186 | Homo sapiens | Q9NVJ2 (AlphaFold model) |
>2AL7_1 ADP-ribosylation factor-like 10C (chains A) MGSSHHHHHHSSGLVPRGSKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMR KVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKP QLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLI QHSKSR
GTP-like conformation of GDP-bound ARL10C GTPase. Ismail, S., Dimov, S., Atanassova, A. et al. To be published.
Other PDB entries of the same protein (UniProt Q9NVJ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.