2AP2: Single chain fv of C219

Single chain fv of C219 in complex with synthetic epitope peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 24 Nov 1999.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Mus musculus, Cricetulus griseus
Chains: 4
Atoms: 3,954
Mol. weight: 61.79 kDa
Released: 24 Nov 1999

Explore 2AP2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AP2 contains 17 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-12	3	2
β-strand	19-25	7	1
β-strand	30-31	2	3
β-strand	36-37	2	3
β-strand	39-44	6	2
α-helix	49-50	2
β-strand	51-55	5	2
β-strand	59-60	2	2
α-helix	61	1
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	91-96	6	2
α-helix	102	1
β-strand	103-104	2	2
β-strand	108-111	4	2
β-strand	116-118	3	4
α-helix	119-121	3
β-strand	122-123	2	5
β-strand	130-136	7	4
α-helix	141-143	3
β-strand	144-151	8	5
β-strand	157-164	8	5
β-strand	169-172	4	5
α-helix	174-176	3
β-strand	180-185	6	4
β-strand	190-195	6	4
α-helix	200-202	3
β-strand	204-212	9	5
β-strand	223	1	5
β-strand	227-230	4	5

Chain C: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	0-3	4
β-strand	4-7	4	6
β-strand	10-12	3	7
β-strand	19-25	7	6
β-strand	30-31	2	8
β-strand	36-37	2	8
β-strand	39-44	6	9
β-strand	51-55	5	9
β-strand	59-60	2	9
β-strand	68-73	6	6
β-strand	76-81	6	6
β-strand	91-96	6	9
α-helix	102	1
β-strand	103-104	2	9
β-strand	109-111	3	7
β-strand	115-118	4	10
α-helix	119-121	3
β-strand	122-123	2	11
β-strand	130-137	8	10
α-helix	141-143	3
β-strand	144-151	8	11
β-strand	157-164	8	11
β-strand	169-172	4	11
α-helix	174-176	3
β-strand	180-185	6	10
α-helix	186-188	3
β-strand	190-195	6	10
α-helix	200-202	3
β-strand	204-212	9	11
β-strand	222-223	2	11
β-strand	227-230	4	11

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single chain fv	A, C	protein	271	Mus musculus	Q505N9 (AlphaFold model), Q6KB05 (AlphaFold model)
P-glycoprotein	P, Q	protein	14	Cricetulus griseus	P21448 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2AP2_1 SINGLE CHAIN FV (chains A, C)
FVRDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWA
STRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEPGGGGS
GGGGSGKSGGGGEVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWI
GRIDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPL
DVWGAGTTVTVPSGSEQKLISEEDLNHHHHH

Sequence of entity 2 (P, Q), FASTA

>2AP2_2 P-GLYCOPROTEIN (chains P, Q)
VVQEALDKAREGRT

Primary citation

Antibody C219 recognizes an alpha-helical epitope on P-glycoprotein. van Den Elsen, J.M., Kuntz, D.A., Hoedemaeker, F.J. et al. Proc Natl Acad Sci U S A (1999) 96:13679-13684. DOI 10.1073/pnas.96.24.13679 · PubMed

Other PDB entries of the same protein (UniProt Q505N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MVU 1.78 Å, Single chain fv of C219 heavy chain V101L mutant in complex with synthetic epitope peptide
1A3R 2.1 Å, FAB fragment (antibody 8F5) complexed with peptide from human rhinovirus (serotype 2)…

Browse structure collections

About this viewer

MolViewer shows 2AP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.